DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kto and dpy-22

Sequence 1:NP_524786.1 Gene:kto FlyBaseID:FBgn0001324 Length:2531 Species:Drosophila melanogaster
Sequence 2:NP_509645.1 Gene:dpy-22 WormBaseID:WBGene00001081 Length:3498 Species:Caenorhabditis elegans

Alignment Length:3703 Identity:714/3704 (19%)
Similarity:1120/3704 (30%) Gaps:1514/3704 (41%)


  Fly    11 LKRT--RLGPPDIYPQDAKQREDELTPTNVKHGFTTTPPLSD------EFGTAHNSNVNASKV-- 65
            |::|  |:|..|:|.|:..|.||.||...:|.|:..  ||:.      .|..:.|..:...|.  
 Worm     2 LRKTNLRMGTADVYKQNKNQEEDMLTTERLKKGYQM--PLTQYELQSLVFNASENKLIRLEKAQK 64

  Fly    66 --SAFFSGVLAKKEELMTLPDTGRK--KQQINCKDNFWP------VSPRRKCTVDAWFKDLAGNK 120
              .:..:.|:.||.|.....|..||  |:|:.|   |.|      :|.|.|     :|..||...
 Worm    65 RSQSMIASVIHKKGEFHMNYDRERKIPKEQLPC---FAPHNWKRILSDRVK-----FFSALARGT 121

  Fly   121 PLLSLAKRAPSFNKKEEIFITLCENQVNMQRATWFIKLSAAYTLSF-TESKNKKRSIYDPAA--- 181
            ||..|::|.|.|.:||.:|:...:..::..||.|.:||..  .|.| :.||.:|:::.|.|.   
 Worm   122 PLQQLSQRIPGFRRKELLFLEFSDYNISYDRAIWCVKLLC--ILGFNSSSKTQKKTLLDVATLEL 184

  Fly   182 ------------------------------EW---TGNMIKFM--------KELLPKLQEYYQQ- 204
                                          .|   ||.| |:|        :|.|..|.|.:.| 
 Worm   185 SQACNKTTIWLVTQLYKSFRNPIKRREATKTWNYLTGFM-KYMFDDGVLDKQEFLNDLTEVFNQL 248

  Fly   205 --------------------------------------------------NHDK-------SSSN 212
                                                              ..||       .|:|
 Worm   249 FLQKNFKNPSVLSTFMKYYVYFVEDLSSSLVLARRSSTLLCQALGFLFEMAQDKRKIDAYYDSAN 313

  Fly   213 GT--------------------------------------------------------TSGSLTA 221
            .|                                                        .:|||..
 Worm   314 KTFIKKEFENEDGEIYEFEDYDDFIDMLDEIPDVPYFDETDKTPEAQAEELIKQHEKRKAGSLKK 378

  Fly   222 A----------------GNGPASNGST------------------GTSSINSVTGSSASTNVIPV 252
            :                ...|::..|.                  |..|.||:...|.|....| 
 Worm   379 SERRRRRGLSKNRPKKMPQNPSNEASLDHDKVQIKQEPMDYDEYGGQQSDNSMDYDSFSHQYDP- 442

  Fly   253 PSMASPLP--PIHS----PANGQQAAPGGGVNAGSVMPTT-----GSL--------GGV-VGGPG 297
              ...|||  |:|:    .....:......:...||.|..     ||:        ||| :..|.
 Worm   443 --SYEPLPFKPLHTDIPKKLTDDEEFKYMKIGKRSVTPERISGRYGSMTYPFWIQQGGVGIDPPK 505

  Fly   298 SSVVGGAAGAGA------------AVPPGSTISGIGSQFE------------------------- 325
            ..|:..:.....            :.|..|....:..:.|                         
 Worm   506 DEVLDFSNPTPTETVNTQPQIDFESSPSASPALSVDKENECEKKEDESKTKEKNKDKEKDKEKEK 570

  Fly   326 ------------------------DSRNALKYWKYCHQ-----------LSKYMYEESLLDRQEF 355
                                    |..:|.:..|...:           .||.....:..::.|.
 Worm   571 SVDEHTNDLDVPINPDDAEMADANDKTDASEKQKLVEEEPTGKENEDDTSSKTAKTSTSAEKSEA 635

  Fly   356 LNWILDLLDKM-----------------------------------RTQASFDEPLKKLVLSFAL 385
            .: |:|..||:                                   .|:.:.:|||:       :
 Worm   636 PS-IVDSNDKIDKEPNASSTSNDETSKDDTVPMESDPPAATEKPKESTEITTEEPLE-------V 692

  Fly   386 QYMHDFVQSERLCRKMAYIV-SKKLAQLLNTVV--------------------EQQTIKELDEPK 429
            ....:..:||:.......|: |.|.|...:.||                    |::..|..|...
 Worm   693 DKAPEVDKSEKEHEDDIMIIESNKKADEDDCVVIAVVDPDQEQTPESEKKKDGEEERDKNKDTDV 757

  Fly   430 LQQDPYELALQEQMS-------------------------------------------CPHHRDI 451
            ...:|.::...|:::                                           |....:.
 Worm   758 ADNEPEKIYTDEELAEIKIRKEKEMKIATLASHIKEKMVSDKKWKEKTSHAGWRTLDQCSQFSEA 822

  Fly   452 VLYLSTILQIITIECPTALVWSGIAA------HRAPSSLLGSPLDHLPLAPSVLPMPTRCPRTNH 510
            :..||:::|.:....|.:.||:.::.      ||....|.|||||:||.....||:....    .
 Worm   823 LHLLSSMVQYMACVTPESFVWNDLSVQQEERRHRILPQLCGSPLDYLPCELHKLPVMEGV----E 883

  Fly   511 EIRRQLRAAESDIVLRTQHAEQRWF--AAKWLSAGK--NQYTSVLATLDHLDTHCFDRMEHNNSI 571
            |:...||....:||.|:|.||.||.  ||...|.|:  :....|:..:|::|      :|..|:|
 Worm   884 EVVDCLRLRHCEIVRRSQAAEDRWLPNAAFLQSFGRIIDTCVDVIGIMDNID------VEKPNAI 942

  Fly   572 DTLYAQIFPSPTVSRRREEDQVEPRPPYEPKQDKDTVRILCEWAVSGQRWGEHRAMVVAILLDKR 636
            .....::|..              |..:|.::......::.:|.::.:|.|..||..:|.||   
 Worm   943 TNAGLRLFAF--------------REKFEKQEALLKTMLMFKWCITEEREGSFRATYIAKLL--- 990

  Fly   637 QIDVTSTPADQQSSDKDDKDSLASGAGLIDGLPVFQHVLMHFLDHDAPVLDEHVSSPQQRTEFTN 701
                      :...|::.:::: .|..::|       :...|:..:.|   :| .|...:..|.:
 Worm   991 ----------RFGMDQNPENTI-GGWQVMD-------LFFKFMSTEGP---KH-GSKMYQAHFDS 1033

  Fly   702 LVQLFSALIRHDVFSHNAYMHTLISRGDLLLESVLVIKSGTTATKTSPPPPAPPPTTTHGFDDDG 766
            .|.:...::|..:||....:..|....||                                    
 Worm  1034 TVAIMIEMMREKIFSITDILRELEKDSDL------------------------------------ 1062

  Fly   767 FGGGLDFKHNEFDDSNVDDDLDKLVQNIKEKGQQHEAPDSPKIGPPGDGETNPGGSISRHYVYTK 831
                      :::...::....:.:..|.::.::.|.||..|:               .|:. |:
 Worm  1063 ----------DYNAPLMERQRKQKIPKISKRHRKPETPDDTKL---------------VHFT-TE 1101

  Fly   832 HFP------------------IPQDDPSMSSYSSESNQRYILLFGVGKERDEKKHAVKKMSKEIG 878
            :.|                  :||.|  :...:.|...|.:||||:....:......:.:.|.|.
 Worm  1102 YTPKRLFMGKKMDLLERMIIILPQLD--VDEDTDEYRLRRLLLFGLKPAANVYFRRARAIYKSIT 1164

  Fly   879 KLFTKKFSIDVAAAGHV----KKHSRNEFN-----FEATTSKCQQMAYFDQHVVTAQCAANVLEQ 934
            |.||.:..|:...:..|    ||.::|..:     |.|.|       |.|||::..:...|.::.
 Worm  1165 KEFTTRLYIEFDRSSKVTTAHKKINQNRLDDLLRQFRAQT-------YHDQHLILERIVYNFIDG 1222

  Fly   935 LNGFALGNNNYLPVQEHVAFLFDLMELALNIYSLLELCDSLLKELPEVEHQL-QLKKSNLVRSYT 998
            :.||...|.:.:|..|....:.::.|.:::|.|:.:..:.:...|..|:.:: ..:...|...|.
 Worm  1223 IGGFLKKNCDDVPAPEVANIICEMYEFSMDITSIFDFFEMVNPYLKAVDDKIAHFRMDVLPDMYY 1287

  Fly   999 TSLALYIVSILRRYHSCLLLSP------EQTLSVFEGVCRTIRHVSNPSECTSAERCIIAYLSDL 1057
            |..|...||...::....||.|      .|...:.:.:.|...|:     .|...|.:..::  .
 Worm  1288 TETAFIFVSFFMKHWQRFLLHPRACAIVNQCFVLIQDMIRADDHM-----ITCWGRTVAIFV--F 1345

  Fly  1058 HESCVLLQGKEQSTEYYQQLQCIKRFKDIFNTPEQLDLPPQGYNPLLLQELFMAPR---RGGKL- 1118
            |....:.....|:.|:..:   ...|..:|...:.:||....:|     |.|...:   |||.| 
 Worm  1346 HARKAIANAGLQNEEFLAE---DSHFWRVFPNAQHVDLDVGYFN-----EDFAGVKLQLRGGTLR 1402

  Fly  1119 -----DPHWLGT---------LH-ESPANVYSFVSNALIAVCRETDN-ERLNDVALACAELTASC 1167
                 |..||.:         .| :.|...||||..|.:...:...| :|:|::|..||.:||:.
 Worm  1403 YDSYNDFKWLVSNMKPNLKKKPHLKRPNTRYSFVVRAFMEARQHGRNFDRINELANYCANITAND 1467

  Fly  1168 NVLSEEWIYALQSLCSGSKSPRYP--HLGGQVDIGQLKTHNALAVFVCILVARHCF----SLADF 1226
            ..|||.||.|::.||..|....||  .:..|:||....||.:|..|:..|..:..|    .||: 
 Worm  1468 PPLSEYWIGAIKGLCFLSLDAPYPFKEMSQQIDISDCSTHYSLTTFITCLAGKSAFYIPRLLAE- 1531

  Fly  1227 VSKFALPTLAR------------------SVSAGGAELSVDAEAGARLTCHLVLKLFKTLEIPQP 1273
            ::|...|.:.|                  |.:.....|| :||.|..| |.|::          .
 Worm  1532 LTKHVFPLMLRHDGRLTSQKTHDVKRKVASKTTESRTLS-EAEPGVCL-CLLII----------C 1584

  Fly  1274 GMYSVSTSPNPL--HAVG---------NDFSIRLSCDRHLLVGAH---KTI-PIAAVLAVLK--- 1320
            |:..|...|..|  |..|         |....|:....|.....|   :|: .|:.:|..|:   
 Worm  1585 GLCCVGDEPFGLSVHYRGIEKKKKRFNNTADERIMHLFHWFEMDHAMFRTLGHISQLLEALQSRC 1649

  Fly  1321 --AILIVVDNAALKTPLASGSGTSSGGLGGAFGSGKRSGFNTPVHPGSTPKSNEQ--------RP 1375
              |.|::..|..:|.|                                 ||..::        ||
 Worm  1650 RDANLVLPKNFPIKNP---------------------------------PKHQQELHREKAPYRP 1681

  Fly  1376 ADLSQILGTSDLQLGSSLTSEPEALQQPSVGGMEQISLLEFAQAVLKQICAQEHVLERCLKNAEQ 1440
            ..|..|..|....:          .:|..|    .:.:..|.|....:...|:.:.:.||  .:|
 Worm  1682 QYLFNIAKTVQFVI----------CEQDWV----TLRMFRFFQTRKMEAFNQDKLKQNCL--GQQ 1730

  Fly  1441 LCDMIIDEMLTAKQAQRVLHMICYPEPEFNIISELDQRSMIVRILENLGQWTLRISWLDLQLMYR 1505
            :..|.:......:...::..           ..::.:::.:.::|..:..|..|.:..||.||.:
 Worm  1731 ILRMALRRRTERENVHKLFE-----------AHKISKKATVDKVLSFMNLWNFRATLFDLMLMIK 1784

  Fly  1506 Q----SLSNNAE-----LNVWLDTVARAAIDVF---HMEEVVLPGAVKATH---KPKPSTWLVAP 1555
            :    ..|.:|:     .:..:..:.:...|:|   :..::.:|.|...|.   ......||:||
 Worm  1785 EISPDGNSRHAQQGAIAADALMSEIGKCCRDMFLSAYKTKIKMPIAKTLTDFRLSDINKFWLIAP 1849

  Fly  1556 LIAKLTP---------------AVQGRILRVAGQVLESMNYFSKVSKSDCNSSGSGDEREKSNSC 1605
            |: ::.|               .|..:.||.|..::::.....|.....|               
 Worm  1850 LV-RMCPKPINIPPQYANTTVGTVAAKFLREAALLMDTPPTTPKERLLQC--------------- 1898

  Fly  1606 HSSNSYGLGGVPARNKKMPLDYQPFLGLILTCLKGQ--DEYKENLLVSLYAQLSQCLQSFAELDT 1668
                |:.:..|            ||:.:|||||:.:  .:.|:..|.|||.||.:        :|
 Worm  1899 ----SWAMSKV------------PFINMILTCLQCEKMQQSKDVFLQSLYTQLQR--------ET 1939

  Fly  1669 IGGIDEPQA-----REEILDALQLRFSLVGGMFEAIQKNSTPTTDWAILLAQLVCQGVVDLSCNR 1728
            :.  |..:.     |.|..|....|.:|:|.:::.|.| :|....|.:|:.||:..|:::....:
 Worm  1940 LR--DHHRRSNWTNRREHRDCTIFRITLIGYIYKEILK-ATHVETWGLLIFQLMFHGIINPVREK 2001

  Fly  1729 ELFTTVVDMLATLVHSTLVSDDERH--------------YMNLMKKLKKEIGEKNNASIR-VIRQ 1778
            .::.|..|||..:|..|||..|..:              |..||||::||:.|:.....| .:.:
 Worm  2002 LIYETCFDMLHHMVLWTLVDGDSMNQHDRYGSIRVRWPQYAGLMKKIRKEMQERFTDQTRNSLHR 2066

  Fly  1779 LLPLYKQPTEVIACEHSGMDTKGNKICDIDKKQLR------------ISDKQRISVWD------- 1824
            .||:.|.....|:.:......|.|:  .:.||.|.            ..:|.:.:.::       
 Worm  2067 FLPIGKMQMSTISYKKYQKRPKVNQ--KMSKKFLAGEGLKNGKYSFLPEEKAKTNAFEHTDHLGD 2129

  Fly  1825 -ILEGHKNPAPLSWVW--FGAVKLERKPLTYEEAHRNLKYHTHSLV--KP----SSYYYEPLPLP 1880
             |::|       .|.:  |...:|::.....:...|:..:|||.|.  :|    |...::.:.|.
 Worm  2130 LIVKG-------GWKFRMFQTTRLDKVAKNVQNVLRSNMHHTHVLEFNRPQLLMSDNMFDDIFLA 2187

  Fly  1881 PEDIE-------PVP-------------------------------------------------- 1888
            |.|||       |||                                                  
 Worm  2188 PPDIEITKIIEQPVPVIDEEEAKKRAEEEKEAAEKKEESKNAEDEKNKNNAENKKDTKEGEKGKS 2252

  Fly  1889 -------EKICIKDEMKAD----------------------------------TPSSVDQSPSAV 1912
                   ||...||..|.|                                  .|:.|.:||:..
 Worm  2253 KDKEKDGEKEKCKDASKKDDVTSEKNELEKRASDAAAATNAPETNKDMDTSTPKPAPVTRSPATR 2317

  Fly  1913 VGGTGRGRGKG----------------------TTTRKRKP----KNP------------KTPPV 1939
            ..|.||.|..|                      .||:...|    .||            ..||:
 Worm  2318 GRGGGRKRNSGARGGGPRAKRANSRADTAQAAAATTQWNAPIANTSNPAAGGNFHAAMRGNQPPM 2382

  Fly  1940 VN-----------------TQQQQPQLAQQ----------------------PQQPQNVQQ---- 1961
            .|                 .::::..||..                      |..|.....    
 Worm  2383 SNGSSDETKVHIRNLLNRKKEEKRNSLADASAAAAAANSNAMGNTSSMPPSGPPMPMGSSMQSAG 2447

  Fly  1962 --QQLQQQQQQQQHMQQQHMQQQQ--MQPNQMGQMP--------MNMPMNMQQF------APNPN 2008
              ||||..|:.|.......|.|..  |..:...|.|        ||.|: |.|:      ||||.
 Worm  2448 ATQQLQGMQKHQMGGSMSGMNQNMGGMNQSMSHQAPPPYSSTNEMNRPL-MNQYGGPHFAAPNPG 2511

  Fly  2009 NM-------------------------------------------------------MQQNAMLQ 2018
            .:                                                       ||:.|.::
 Worm  2512 PLNRSSGPVSSETRQQIMEQQMREKLAAHHQLVEQQKQRDAREREAREREAREHQERMQREAYMK 2576

  Fly  2019 QQQ-------------------------------------------------------------- 2021
            :||                                                              
 Worm  2577 EQQLLERKRAIEENNRIMEEQQREREMEAARKEAARRAAEEAYAAEQQRLELLRRQEEERLRKEA 2641

  Fly  2022 ---------------QQQMQ--------------------------------------------- 2026
                           |:||:                                             
 Worm  2642 EERMRIQRENEERVRQEQMRLEAEERERIRRAEEERIQKELEDKVRREKEEAARQEKERQEQEAR 2706

  Fly  2027 -------QMGNNPMQQQLNVGGGNGQPNPQMNFMQQGPGGGGAGPQGMPGQQQQWHNAPQQQQPP 2084
                   ::....|:||     ...|.||.||                  ||.|:     .||||
 Worm  2707 MREAREAELSRQRMEQQ-----RRSQQNPYMN------------------QQGQY-----SQQPP 2743

  Fly  2085 QPYH-----NQYAPHQQNMQSNRIERPP-------LNANSKQALSQM---LRQRQPFQ----QQA 2130
            ..|.     |.|.|.||..|....::|.       ..|..:|..:||   ::|:|..|    ||:
 Worm  2744 PSYQQSSYPNNYQPGQQGNQPPNYQQPSHQSMQQGHQAGYQQTSNQMQMNMQQQQNRQQGGPQQS 2808

  Fly  2131 QQGPGG----------GFN---------PMQQQ-----PQASQQQPGPQQQMN--PNQMRQQQMN 2169
            ..||||          |:|         .||||     .|...||||..:.|:  ||:...||..
 Worm  2809 FSGPGGINQPSQPGYSGYNQQGGQGQQGQMQQQRNPFGNQQDMQQPGAAKLMHAKPNEAHAQQYQ 2873

  Fly  2170 PQQNPQSVAA-------FNAMQ-QQPQQNAQQQQM--------------NPNQQQQ--QQFMRGG 2210
            ..||..|:|.       |.|.. |..|.||||||.              .|..|||  .....|.
 Worm  2874 HTQNQLSLAQKEKEKQYFQAKNLQASQANAQQQQQRFGDVVAGNVAGYGRPYGQQQLGASDQMGT 2938

  Fly  2211 NMRPGMAPNQMNQMNMGGQG-----MSQNPMM------------QQQIPQNMVGMVN-------- 2250
            :..||.:.::|||.:...||     ..|.|::            |||||.......|        
 Worm  2939 SQLPGASTSRMNQGSSNPQGGMQSYQQQQPVLGQPGPIQTGQSTQQQIPAQSQQQYNSGRPQMHT 3003

  Fly  2251 -PNANQM--MQSGGAQG--GNGVGVGVG-VGVGGAGNN------------------------PNM 2285
             |..|.|  ....||.|  .|.:|.|.. .|.|..|.|                        ||.
 Worm  3004 TPTKNDMSARAPSGAMGQIANRMGHGTNPQGYGSTGQNVPGGYQQGQQQSGQGSYPQAQQQQPNQ 3068

  Fly  2286 GMGGMPQQGMIQQQPQQQP--------QQQVQF----------QNFQNQ-----YQQ--QQQQGM 2325
            ..|...|.|...||.||||        |...||          |:..||     ||:  |||||.
 Worm  3069 YSGSNQQVGQQAQQQQQQPLNQNVSQSQSAAQFGRPSQDSAYQQSGYNQTGNQSYQRPDQQQQGA 3133

  Fly  2326 QQQGGGAGVGVGVGMAPN----QQQQQQANMMGNFNPQMQQGNRNNPDFMAAAAV------AQQQ 2380
            ||....     |...|.|    |||.||.......:.|.||..:...:.||.:|.      .||.
 Worm  3134 QQNQWS-----GSNQAQNQLRSQQQAQQPLQQPQQSQQFQQPAQQAKNPMAQSAQYGGFGGQQQG 3193

  Fly  2381 QQQQQQQRVVPGGMMAGNRNQYMNQAPNVTMSTMMGPGPGGVV---------------------- 2423
            ..||||.::.|  ..|.|.....:.....|.....|.|..|..                      
 Worm  3194 YDQQQQGQIAP--QQAQNPQASQSYGQQQTQQNRYGMGSSGYTANSGGSSNILNQSMEESGLNQG 3256

  Fly  2424 ---------GQVPPYARQQSAGGGKPGVLNTQQQFQQQQQQQQQLRHQMMQLQGMGGGAGGGMGA 2479
                     .|....::.|.:|.|.||     .|.|.||.|:||::..|.  .|||....|..|.
 Worm  3257 FSGASSNASSQQGGSSQMQQSGYGMPG-----NQMQMQQNQKQQVQRGMP--TGMGQTNMGQSGM 3314

  Fly  2480 GPQQGGGAVG---GGAGGGMVPQQQSMNQQQTPNLVAQLQRQNMM-----------GQQQYQP 2528
            | |.|.|..|   .|.|||:..|.|...|.|.|. |:|.|.|..|           ||||:||
 Worm  3315 G-QSGMGQTGMSRSGLGGGIGQQGQQSQQPQQPQ-VSQQQNQRGMNPGAQLPPYSTGQQQHQP 3375

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ktoNP_524786.1 Med12 99..157 CDD:286572 19/64 (30%)
Med12-LCEWAV 390..856 CDD:288959 93/558 (17%)
dpy-22NP_509645.1 Med12 99..158 CDD:286572 19/64 (30%)
Med12-LCEWAV 815..>990 CDD:288959 50/199 (25%)
ARGLU <2523..2662 CDD:291991 8/139 (6%)
MAP7 <2623..2729 CDD:283355 7/111 (6%)
GBP_C <2630..2728 CDD:303769 7/103 (7%)
PHA00671 2690..>2760 CDD:106979 20/98 (20%)
coiled coil 2710..2721 CDD:293879 1/11 (9%)
RCR <2728..2784 CDD:304939 20/79 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C348071287
eggNOG 1 0.900 E1_KOG3598
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 358 1.000 Inparanoid score I1285
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003586
OrthoInspector 1 1.000 T476936
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR46007
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2630
TreeFam 00.000 Not matched by this tool.
98.920

Return to query results.
Submit another query.