DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: abo and DET1

Sequence 1:NP_524784.1 Gene:abo FlyBaseID:FBgn0000018 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_192756.2 Gene:DET1 AraportID:AT4G10180 Length:543 Species:Arabidopsis thaliana

Alignment Length:564 Identity:130/565 (23%)
Similarity:236/565 (42%) Gaps:126/565 (22%)


  Fly    40 RLFYKCITPCLTIDSITIPPIYLRKFTPDGRKLLAFSQDQRSLLI-------YSYGGSSCAAVGE 97
            |.||:.:.|..|:..:..|....||||.||..|::||::.:.|::       ||....|...:..
plant    29 RHFYENLVPSYTLYDVESPDHCFRKFTEDGLFLISFSRNHQELIVYRPSWLTYSTTDDSTTTLPP 93

  Fly    98 LIRQADVGSGECFSSQDTILKSRIFERLFPTKETLNLCQG------DFGLYYLHREFSVFLEEGR 156
            |.|:|..                 |:..|....::||...      ||.||:..|.|.:|     
plant    94 LPRRASK-----------------FDSFFTQLYSVNLASSNELICKDFFLYHQTRRFGLF----- 136

  Fly   157 YAMLAAMTVVRGALPVDDYVRYPDLFDKVDAFSYVFFLVDLKLGVVTDRLILPNDSIVIAHNHGI 221
              ..:...:...:.|.:|.|......||:     .|.|:.|..|||.|..:..:|.:.:|||.|:
plant   137 --ATSTAQIHDSSSPSNDAVPGVPSIDKI-----TFVLLRLDDGVVLDERVFLHDFVNLAHNMGV 194

  Fly   222 SVFGSTVMMMSRLHQCVYVYWVNDG--------------------------------KFHQQETI 254
            .::...:.::|..:|.:::..:.|.                                |..||...
plant   195 FLYDDLLAILSLRYQRIHLLQIRDSGHLVDARAIGYFCREDDELFLNSSSQAMMSQDKSKQQSLS 259

  Fly   255 GPRPRDFIEKATTDFDNLDATTVLP------ITHIKQRVLSFLYRKI-NDKSGNPTESQ---KSF 309
            |.:..|      |..:.|..:...|      ::.:|||:|||::|:| |::|.|....|   |.|
plant   260 GSKEDD------TGENGLRHSLSQPSGSNSFLSGVKQRLLSFIFREIWNEESDNVMRVQSLKKKF 318

  Fly   310 YKNFEYIEHMIMERMHLVNNELLMLRYEERPNG----TDTMPMATSPRRLYVFYTITGEEVVGVY 370
            |.:|:....:|:.::..::.:.|::::.....|    .|..|      ..:..|.:...::|..|
plant   319 YFHFQDYVDLIIWKVQFLDRQHLLIKFGSVDGGVTRSADHHP------AFFAVYNMETTDIVAFY 377

  Fly   371 PEYSVNLLQILLQFNDYMSNDRSLQFGDAPSLPMHFFLRHTFADSNESVSVD--RHTALRFNP-- 431
            ...:.:|.|:..||:|:.:...|..|       |:|...|    ||...:::  ::|..:.|.  
plant   378 QNSAEDLYQLFEQFSDHFTVSSSTPF-------MNFVTSH----SNNVYALEQLKYTKNKSNSFS 431

  Fly   432 --------SVPLSSQSLSSSPYLKFNEFRYDSRYVSPLEQPHRCCNDPIVFLD-RATDSIKFRLH 487
                    |:|.|.||.|.|||...:.||:|.:.:|..::..:..::||.|:. |...::||::.
plant   432 QFVKKMLLSLPFSCQSQSPSPYFDQSLFRFDEKLISAADRHRQSSDNPIKFISRRQPQTLKFKIK 496

  Fly   488 ATARRHLNPLAPRELCAFIWHPFDPLVLSIQKC--MNSYVYHVH 529
            ............:::|:|::||..||.:|||:.  |...|.::|
plant   497 PGPECGTADGRSKKICSFLFHPHLPLAISIQQTLFMPPSVVNIH 540

Known Domains:


GeneSequenceDomainRegion External IDIdentity
aboNP_524784.1 Det1 146..531 CDD:286780 100/446 (22%)
DET1NP_192756.2 Det1 122..542 CDD:286780 104/455 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 125 1.000 Inparanoid score I1886
OMA 1 1.010
OrthoDB 1 1.010 D603320at2759
OrthoInspector 1 1.000 T193205
orthoMCL 1 0.900 OOG5_132401
Panther 1 1.100 LDO PTHR13374
Phylome 1 0.910 0.667 Consistency score
87.980

Return to query results.
Submit another query.