DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: abo and Det1

Sequence 1:NP_524784.1 Gene:abo FlyBaseID:FBgn0000018 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_083861.1 Gene:Det1 MGIID:1923625 Length:550 Species:Mus musculus

Alignment Length:569 Identity:153/570 (27%)
Similarity:274/570 (48%) Gaps:77/570 (14%)


  Fly     5 KRLQSQNLVHLLQNRESGYTNVGQQPGRMPLLAYERLFYKCITPCLTIDSITIPPIYLRKFTPDG 69
            :|:|:||::|.|:.|.......|....::      |:|::.:.|..|:.::..||.:||||:|||
Mouse    11 RRIQNQNVIHRLERRRISSGKAGTHWHQV------RVFHQNVFPNFTVVNVEKPPCFLRKFSPDG 69

  Fly    70 RKLLAFSQDQRSLLIYSYGGSSCAAVGELIRQADVGSGECFSS----QDTILKSRIFERLFPTKE 130
            |..:|||.||.||.||.|.|  |.|..:|::..:   ||..|:    :...::.|:|||.|....
Mouse    70 RYFIAFSSDQTSLEIYEYQG--CQAAEDLLQGYE---GEILSNGNDQRSVSIRGRLFERFFVLLH 129

  Fly   131 TLNL-CQGDFGLYYLHREFSVFLEEGRYAMLAAMTVVRGALPVDDYVRYPDLFDKVDAFS----- 189
            ..|: ..|:    :|:||.|:|.::.|..::.:...    ||.:.:..:.:::...::.:     
Mouse   130 ITNVAANGE----HLNRECSLFTDDCRCVIVGSAAY----LPDEPHPPFYEVYRNSESVTPNPRS 186

  Fly   190 ----YVFFLVDLKLGVVTDRLILPNDSIVIAHNHGISVFGSTVMMMSRLHQCVYVYWVN-DGKFH 249
                |...::||..|.:.|......|.:|::||.|:.::.:.:.::|...|.::|:.|. :|.|.
Mouse   187 PLEDYSLHIIDLHTGRLCDTRTFKCDKVVLSHNQGLYLYKNILAILSVQQQTIHVFQVTPEGTFI 251

  Fly   250 QQETIGPRPRDFIEKATTDFDNLDATTVLP------------------ITHIKQRVLSFLYRKIN 296
            ...|||        :...:.|.|..:.|.|                  |..:|.|:|.:|:|:. 
Mouse   252 DVRTIG--------RFCYEDDLLTVSAVFPEVQRDSQTGMANPFRDPFINSLKHRLLVYLWRRA- 307

  Fly   297 DKSGNPTESQKSFYKNFEYIEHMIMERMHLVNNELLMLRYEERPNGTDTMPM-ATSPRR--LYVF 358
            ::.|: ..:::.|::.|:.:..:.|.:|.|::...|.::|    ...|.:.: .|.|.:  .:|.
Mouse   308 EQDGS-AMAKRRFFQYFDQLRQLRMWKMQLLDENHLFIKY----TSEDVVTLRVTDPSQASFFVV 367

  Fly   359 YTITGEEVVGVYPEYSVNLLQILLQFNDYMSN---DRSLQFG-DAPSLPMHFFLRHTFADSNESV 419
            |.:...||:.|:...|..||::...|.|...|   ...:||. .|.|......::..|.|:..:.
Mouse   368 YNMVTTEVIAVFENTSDELLELFENFCDLFRNATLHSEVQFPCSASSNNFARQIQRRFKDTIINA 432

  Fly   420 SVDRHT--ALRFNPSVPLSSQSLSSSPYLKFNEFRYDSRYVSPLEQPHRCCNDPIVFLDRATDSI 482
            ....||  ..|....:|:|:||.|.||||..:.|.||.::||.:|:|..|.:.||.|..|.:..:
Mouse   433 KYGGHTEAVRRLLGQLPISAQSYSGSPYLDLSLFSYDDKWVSVMERPKTCGDHPIRFYARDSGLL 497

  Fly   483 KFRLHA-TARRHLNPLAPRELCAFIWHPFDPLVLSIQKCMNSYVYHVHL 530
            ||.:.| ...|.:|... |.|.||.:|||:|..:|:|:....||.:.|:
Mouse   498 KFEIQAGLLGRPINHTV-RRLVAFTFHPFEPFAISVQRTNAEYVVNFHM 545

Known Domains:


GeneSequenceDomainRegion External IDIdentity
aboNP_524784.1 Det1 146..531 CDD:286780 106/424 (25%)
Det1NP_083861.1 Det1 142..546 CDD:313033 106/424 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C205261310
eggNOG 1 0.900 E1_KOG2558
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 188 1.000 Inparanoid score I3882
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007981
OrthoInspector 1 1.000 T1084426
orthoMCL 1 0.900 OOG5_132401
Panther 1 1.100 LDO PTHR13374
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5501
TreeFam 1 0.960
1211.790

Return to query results.
Submit another query.