DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: abo and det1

Sequence 1:NP_524784.1 Gene:abo FlyBaseID:FBgn0000018 Length:539 Species:Drosophila melanogaster
Sequence 2:XP_004912704.1 Gene:det1 XenbaseID:XB-GENE-960176 Length:556 Species:Xenopus tropicalis

Alignment Length:577 Identity:156/578 (27%)
Similarity:277/578 (48%) Gaps:83/578 (14%)


  Fly     5 KRLQSQNLVHLLQNRESGYTNVGQQPGRMPLLAYERLFYKCITPCLTIDSITIPPIYLRKFTPDG 69
            :|:|:||::|.|:.|:......|....::      |:|::.:.|..|:.::..||.:||||:|||
 Frog    14 RRIQNQNVIHRLELRKISSGKPGSHWHQV------RIFHQNVFPNYTVVNVEKPPCFLRKFSPDG 72

  Fly    70 RKLLAFSQDQRSLLIYSYGGSSCAAVGELIRQADVGSGECFSS----QDTILKSRIFERLFPTKE 130
            |..:|||.||.||.||.|.|  |.|..:|:...:   ||..::    :...::.::|||.|....
 Frog    73 RYFIAFSSDQTSLEIYEYQG--CQAAEDLLHGYE---GEILANSNDQRSVNIRGKLFERFFVLLN 132

  Fly   131 TLNLC-QGDFGLYYLHREFSVFLEEGRYAMLAAMTVVRGALPVDDYVRYPDLFDKVDAFS----- 189
            ..|:. .|:    :|:||.|:|.::.||.::.:...    ||.:.|..:.:::...::.:     
 Frog   133 ITNVASNGE----HLNRECSLFTDDCRYVIVGSAAY----LPEEPYPPFYEIYRNSESVTPNPRS 189

  Fly   190 ----YVFFLVDLKLGVVTDRLILPNDSIVIAHNHGISVFGSTVMMMSRLHQCVYVYWVN-DGKFH 249
                |...::||..|.:.|......|.|:::||.|:.::.:.:.::|...|.::|:.|. :|.|.
 Frog   190 PLEDYSLHIIDLHTGKLCDSRTFKCDKIILSHNQGLYLYKNILAVLSVQQQTIHVFQVTPEGTFI 254

  Fly   250 QQETIGPRPRDFIEKATTDFDNLDATTVLP------------------ITHIKQRVLSFLYRKIN 296
            ...|||        :...:.|.|..:.|.|                  |..:|.|:|.:|:|:. 
 Frog   255 DVRTIG--------RFCYEDDLLILSAVYPEVQRETQTGMANLYKEPFINSLKHRLLVYLWRRA- 310

  Fly   297 DKSGNPTESQKSFYKNFEYIEHMIMERMHLVNNELLMLRYEE------RPNGTDTMPMATSPRRL 355
            ::.|: ..:::.|::.|:.:..:.|.:|.|::...|.::|..      |.|.    |....| ..
 Frog   311 ERDGS-AMAKRRFFQYFDQLRQLRMWKMQLLDENHLFIKYTSEDVVTLRVND----PSQVQP-SF 369

  Fly   356 YVFYTITGEEVVGVYPEYSVNLLQILLQFNDYMSN----DRSLQFG-DAPSLPMHFFLRHTFADS 415
            :|.|.:...||:.|:...|..||::...|.|...|    ..::||. .|.|......::..|.|:
 Frog   370 FVVYNMVTTEVIAVFENTSNELLELFENFCDLFRNATLHSEAVQFPCSASSNNFARQIQRRFKDT 434

  Fly   416 NESVSVDRHT--ALRFNPSVPLSSQSLSSSPYLKFNEFRYDSRYVSPLEQPHRCCNDPIVFLDRA 478
            ..:.....||  ..|....:|:|:||.|.||||..:.|.||.::||.:|:|..|.:.||.|..|.
 Frog   435 IVNAKYGGHTEAVRRLLSQLPISAQSYSGSPYLDLSLFSYDDKWVSVMERPKTCGDHPIRFYARD 499

  Fly   479 TDSIKFRLHA-TARRHLNPLAPRELCAFIWHPFDPLVLSIQKCMNSYVYHVHLYNHS 534
            :..:||::.| ...|.:|... |.|.||.:|||:|..:|:|:....||.:.|: .||
 Frog   500 SGLLKFKIQAGLLGRPINHTV-RRLVAFTFHPFEPFAISVQRTNAEYVVNFHM-RHS 554

Known Domains:


GeneSequenceDomainRegion External IDIdentity
aboNP_524784.1 Det1 146..531 CDD:286780 109/427 (26%)
det1XP_004912704.1 Det1 145..552 CDD:286780 109/428 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C205263194
eggNOG 1 0.900 E1_KOG2558
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D272605at33208
OrthoFinder 1 1.000 FOG0007981
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.720

Return to query results.
Submit another query.