DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: eEF1gamma and GstD2

Sequence 1:NP_001189308.1 Gene:eEF1gamma FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_524912.1 Gene:GstD2 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster

Alignment Length:236 Identity:59/237 (25%)
Similarity:97/237 (41%) Gaps:50/237 (21%)


  Fly     7 YTYPENFRAYKALIAAQYSGAQV-KVADNFKFGETNKSAEFLKKFPGGKVPAFETAEGQYLSESN 70
            |..|........::.|:..|.:: |...|...||..| .||:|..|...:|.. ...|..:.||.
  Fly     4 YYMPGGGGCRTVIMVAKALGLELNKKLLNTMEGEQLK-PEFVKLNPQHTIPTL-VDNGFSIWESR 66

  Fly    71 AIA-----------YLLANEQLRGGKCPFVQAQVQQWISFADNEIVPASCAWVFPLLGILPQQKN 124
            |||           |||.|:       |..:|.:.|.:.|....:..:...:.:||.        
  Fly    67 AIAVYLVEKYGKDDYLLPND-------PKKRAVINQRLYFDMGTLYESFAKYYYPLF-------- 116

  Fly   125 STAKQEAEAVLQQ-------LNQKLQDATFLAGERITLADIVVFS--SLLHLYEYVLEPSVRSAF 180
            .|.|..::..|::       |:..|:...::||:::|:|||.:.|  |...:.|:..     |.:
  Fly   117 RTGKPGSDEDLKRIETAFGFLDTFLEGQEYVAGDQLTVADIAILSTVSTFEVSEFDF-----SKY 176

  Fly   181 GNVNRWFVTILNQKQVQAVVKDY---KLCEKALVFDPKKYA 218
            .||:||:.   |.|:|.....:.   .:..||| ||.:|.|
  Fly   177 SNVSRWYD---NAKKVTPGWDENWEGLMAMKAL-FDARKLA 213

Known Domains:


GeneSequenceDomainRegion External IDIdentity
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 24/84 (29%)
GstA 5..187 CDD:223698 49/201 (24%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 28/131 (21%)
EF1G 271..376 CDD:279041
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 20/72 (28%)
GST_C_Delta_Epsilon 88..204 CDD:198287 27/132 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C91259729
eggNOG 1 0.900 E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.