DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1gamma and GstO3

DIOPT Version :10

Sequence 1:NP_652000.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster


Alignment Length:34 Identity:14/34 - (41%)
Similarity:15/34 - (44%) Gaps:7/34 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   388 DYEVYDWKKLDAKSEETKKLVTQYFSWSGTDKDG 421
            ||    |..||...||..|..|.||   |.:|.|
  Fly   140 DY----WTALDIFEEELTKRGTPYF---GGNKPG 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1gammaNP_652000.1 GST_N_EF1Bgamma 4..79 CDD:239342
GST_C_EF1Bgamma_like 90..209 CDD:198290
EF1G 273..376 CDD:459888
GstO3NP_648234.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 3..95 CDD:469754
GST_C_Omega 109..230 CDD:198293 14/34 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.