DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: eEF1gamma and GstE3

Sequence 1:NP_001189308.1 Gene:eEF1gamma FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_611325.2 Gene:GstE3 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster

Alignment Length:156 Identity:45/157 (29%)
Similarity:74/157 (47%) Gaps:19/157 (12%)


  Fly    45 EFLKKFPGGKVPAFETAEGQYLSESNAI-AYLLA----NEQLRGGKCPFVQAQVQQWISFADNEI 104
            ||||..|...|||.:. .|.||::|:|| :||::    |:.|. .|....:|.|.|.:.:..:.:
  Fly    45 EFLKINPLHTVPALDD-NGFYLADSHAINSYLVSKYGRNDSLY-PKDLKKRAIVDQRLHYDSSVV 107

  Fly   105 VPASCAWVFPLLGILPQQKNSTAKQEA-----EAVLQQLNQKLQDATFLAGERITLADIVVFSSL 164
            .....|..|||.     .:|.|...:|     |.|.:.||..|::..:|||:.:|:||..|.:.|
  Fly   108 TSTGRAITFPLF-----WENKTEIPQARIDALEGVYKSLNLFLENGNYLAGDNLTIADFHVIAGL 167

  Fly   165 LHLYEYVLEPSVRSAFGNVNRWFVTI 190
            ...:.::  |...:.:..:..|...|
  Fly   168 TGFFVFL--PVDATKYPELAAWIKRI 191

Known Domains:


GeneSequenceDomainRegion External IDIdentity
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 17/39 (44%)
GstA 5..187 CDD:223698 44/152 (29%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 26/107 (24%)
EF1G 271..376 CDD:279041
GstE3NP_611325.2 GstA 4..195 CDD:223698 45/157 (29%)
GST_N_Delta_Epsilon 4..77 CDD:239343 16/33 (48%)
GST_C_Delta_Epsilon 91..208 CDD:198287 26/109 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C91163029
eggNOG 1 0.900 E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.