DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: miple2 and PTN

Sequence 1:NP_001261198.1 Gene:miple2 FlyBaseID:FBgn0029002 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001308315.1 Gene:PTN HGNCID:9630 Length:168 Species:Homo sapiens

Alignment Length:121 Identity:31/122 (25%)
Similarity:44/122 (36%) Gaps:50/122 (41%)


  Fly   156 GSTCRYAKSAWSNCDHKTNMRSRVLSLRKGEQN--CLPTRTIQKKCKKGARGCRYEKGEWSQCVG 218
            |:.|:|...||..||..|.:::|..||::...|  |..|.||.|.|                   
Human    96 GAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPC------------------- 141

  Fly   219 GQITREDKLEPEATGGSDQNCNPVRTVSKKCKANGNSSGGKQHGQSRRTKEQKQKD 274
            |::|   |.:|:|.             |||.|..|.             |::|..|
Human   142 GKLT---KPKPQAE-------------SKKKKKEGK-------------KQEKMLD 168

Known Domains:


GeneSequenceDomainRegion External IDIdentity
miple2NP_001261198.1 PTN_MK_C 156..201 CDD:279437 18/47 (38%)
PTN_MK_C 205..255 CDD:279437 10/50 (20%)
PTNNP_001308315.1 PTN_MK_N 47..131 CDD:321956 12/35 (34%)
Chondroitin sulfate binding. {ECO:0000269|PubMed:26896299} 92..99 1/3 (33%)
Chondroitin sulfate binding. {ECO:0000269|PubMed:26896299} 123..131 1/8 (13%)
Chondroitin sulfate A binding. {ECO:0000269|PubMed:26896299} 147..168 9/47 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1489280at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.