DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment miple2 and PTN

DIOPT Version :9

Sequence 1:	NP_001261198.1	Gene:	miple2 / 44787	FlyBaseID:	FBgn0029002	Length:	282	Species:	Drosophila melanogaster
Sequence 2:	NP_001308315.1	Gene:	PTN / 5764	HGNCID:	9630	Length:	168	Species:	Homo sapiens

Alignment Length:	121	Identity:	31/121 - (25%)
Similarity:	44/121 - (36%)	Gaps:	50/121 - (41%)

- Green bases have known domain annotations that are detailed below.

  Fly   156 GSTCRYAKSAWSNCDHKTNMRSRVLSLRKGEQN--CLPTRTIQKKCKKGARGCRYEKGEWSQCVG 218
            |:.|:|...||..||..|.:::|..||::...|  |..|.||.|.|
Human    96 GAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPC------------------- 141

  Fly   219 GQITREDKLEPEATGGSDQNCNPVRTVSKKCKANGNSSGGKQHGQSRRTKEQKQKD 274
            |::|   |.:|:|.             |||.|..|.             |::|..|
Human   142 GKLT---KPKPQAE-------------SKKKKKEGK-------------KQEKMLD 168

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
miple2	NP_001261198.1	PTN_MK_C	156..201	CDD:279437	18/46 (39%)
miple2	NP_001261198.1	PTN_MK_C	205..255	CDD:279437	10/49 (20%)
PTN	NP_001308315.1	PTN_MK_N	47..131	CDD:413342	12/34 (35%)
		Chondroitin sulfate binding. /evidence=ECO:0000269\|PubMed:26896299	92..99		1/2 (50%)
		Chondroitin sulfate binding. /evidence=ECO:0000269\|PubMed:26896299	123..131		1/7 (14%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	139..168		14/76 (18%)
		Chondroitin sulfate A binding. /evidence=ECO:0000269\|PubMed:26896299	147..168		9/46 (20%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1489280at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	1.010