DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: miple2 and miple1

Sequence 1:NP_001261198.1 Gene:miple2 FlyBaseID:FBgn0029002 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001261197.1 Gene:miple1 FlyBaseID:FBgn0027111 Length:185 Species:Drosophila melanogaster

Alignment Length:134 Identity:63/135 (47%)
Similarity:82/135 (61%) Gaps:18/135 (13%)


  Fly   144 NRKGPKAATPENGSTCRYAKSAWSNCDHKTNMRSRVLSLRKGEQNCLPTRTIQKKCKKGARGCRY 208
            |.:|.|:    :|.:|||.|:.|:.||.|||.|||.|:|:||:..|..||||||||||   .|||
  Fly    65 NERGTKS----DGLSCRYGKNPWTECDTKTNTRSRTLTLKKGDPACDQTRTIQKKCKK---ACRY 122

  Fly   209 EKGEWSQCVGGQITREDKLEPEATGGSDQNCNPVRTVSKKCKANGNSSGGKQHGQSRRTKEQKQK 273
            |||.||:|..||:||.|||:    ..||.:|...|.:.|.||.      ||...:|.: :::|.|
  Fly   123 EKGSWSECATGQMTRADKLK----ASSDPSCEATRVIKKNCKP------GKSKDKSAK-EQRKNK 176

  Fly   274 DKGA 277
            ||.|
  Fly   177 DKAA 180

Known Domains:


GeneSequenceDomainRegion External IDIdentity
miple2NP_001261198.1 PTN_MK_C 156..201 CDD:279437 28/45 (62%)
PTN_MK_C 205..255 CDD:279437 23/50 (46%)
miple1NP_001261197.1 PTN_MK_C 73..118 CDD:279437 28/45 (62%)
PTN_MK_C 119..170 CDD:279437 26/61 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C141064676
eggNOG 1 0.900 E1_2D544
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1489280at2759
OrthoFinder 1 1.000 FOG0005340
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21050
RoundUp 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.