DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: miple2 and ptn

Sequence 1:NP_001261198.1 Gene:miple2 FlyBaseID:FBgn0029002 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001003981.2 Gene:ptn ZFINID:ZDB-GENE-030624-1 Length:158 Species:Danio rerio

Alignment Length:112 Identity:25/113 (22%)
Similarity:39/113 (35%) Gaps:39/113 (35%)


  Fly   129 GGSKQQRGHSQHHG-------------------GNRKGPKAAT-------------PEN-----G 156
            ||..:::|..:...                   |.|:|.::..             |.|     |
Zfish    23 GGKTEKQGKKERKSDCGEWQWSVCVANEGDCGLGTREGTRSGNDCKQTIKTQRCKIPCNWKKQFG 87

  Fly   157 STCRYAKSAWSNCDHKTNMRSRVLSLRKG--EQNCLPTRTIQKKCKK 201
            ..|:|...||..||..|.|::|...|::.  :.||..|.:..|.|.|
Zfish    88 GECKYDFQAWGECDSTTGMKTRTGVLKRALMDANCPNTVSATKPCGK 134

Known Domains:


GeneSequenceDomainRegion External IDIdentity
miple2NP_001261198.1 PTN_MK_C 156..201 CDD:279437 16/47 (34%)
PTN_MK_C 205..255 CDD:279437
ptnNP_001003981.2 PTN_MK_N 38..122 CDD:295331 17/84 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1489280at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.