DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: miple2 and mdka

Sequence 1:NP_001261198.1 Gene:miple2 FlyBaseID:FBgn0029002 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_571145.1 Gene:mdka ZFINID:ZDB-GENE-990621-1 Length:146 Species:Danio rerio

Alignment Length:150 Identity:35/150 (23%)
Similarity:53/150 (35%) Gaps:38/150 (25%)


  Fly    72 RNNRKPNKPQEHSQQVGAHKSGSRKLVVAENGGALSSQLPQPNHKQGHKNTDKQQRGGGSKQQRG 136
            :|.::.||..:..........||   .||.||..                      |.|.::...
Zfish    24 KNKKEKNKGGKGGADCAEWLYGS---CVANNGDC----------------------GQGMREGTC 63

  Fly   137 HSQHHGGNRKGPKAATPENGSTCRYAKSAWSNCDHKTNMRSRVLSLRKGEQN--CLPTRTIQKKC 199
            :.|......:.|.....|.|:.|:|....|..||..|:.:||..:|:|...|  |..|.::.|.|
Zfish    64 NEQTRKVKCRVPCNWKKEFGADCKYKFGNWGECDAATSTKSRTGTLQKALFNVECQQTVSVTKPC 128

  Fly   200 -------KKGARGCRYEKGE 212
                   .||.:|    ||:
Zfish   129 TTKVKNKPKGKKG----KGK 144

Known Domains:


GeneSequenceDomainRegion External IDIdentity
miple2NP_001261198.1 PTN_MK_C 156..201 CDD:279437 16/54 (30%)
PTN_MK_C 205..255 CDD:279437 3/8 (38%)
mdkaNP_571145.1 PTN_MK_N 39..118 CDD:295331 23/104 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1489280at2759
OrthoFinder 1 1.000 FOG0005340
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.