DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment miple2 and ptn

DIOPT Version :10

Sequence 1:NP_001261198.1 Gene:miple2 / 44787 FlyBaseID:FBgn0029002 Length:282 Species:Drosophila melanogaster
Sequence 2:XP_004912529.1 Gene:ptn / 100101785 XenbaseID:XB-GENE-481634 Length:161 Species:Xenopus tropicalis


Alignment Length:63 Identity:21/63 - (33%)
Similarity:31/63 - (49%) Gaps:7/63 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 KGPKAATPEN-----GSTCRYAKSAWSNCDHKTNMRSRVLSLRKGEQN--CLPTRTIQKKCKK 201
            |..|...|.|     |:.|:|....|.:||.:|.:::|..||::...|  |..|.|:.|.|.|
 Frog    75 KTQKCKIPCNWKKQFGAECKYQFQEWGDCDPETGLKTRTGSLKRALHNAECQKTVTLSKPCGK 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
miple2NP_001261198.1 PTN_MK_C 156..214 CDD:460059 17/48 (35%)
ptnXP_004912529.1 PTN_MK_N 41..125 CDD:470593 15/49 (31%)

Return to query results.
Submit another query.