DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ady43A and ADO1

Sequence 1:NP_651995.1 Gene:Ady43A FlyBaseID:FBgn0026602 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_012639.1 Gene:ADO1 SGDID:S000003866 Length:340 Species:Saccharomyces cerevisiae

Alignment Length:353 Identity:92/354 (26%)
Similarity:152/354 (43%) Gaps:42/354 (12%)


  Fly    31 VICFGNVLLDRLVQLEDPQLLERFGLELGSKGELDMEKLNQLAAEASES--SRCLTNP------G 87
            ::..||.|||....: ..:.|.::.|:     |.|...::..:.:|..:  ...|..|      |
Yeast     5 LVVLGNPLLDFQADV-TAEYLAKYSLK-----ENDAILVDAKSGDAKMAIFDELLQMPETKLVAG 63

  Fly    88 GSALNTAR-ILKQLGT-DALFFGAVGADKHAEELRQIIRDRGIEARLQTVEDAHTGQCVCLMYQD 150
            |:|.|||| ....||. ..::||:||.||.:|.|.......|:::..|...|..||:|..|:...
Yeast    64 GAAQNTARGAAYVLGAGQVVYFGSVGKDKFSERLLNENEKAGVKSMYQVQNDIGTGKCAALITGH 128

  Fly   151 NPTLYANIGASAQFEVQTLSHAVSHEGQSFLRPVERKQILYVEGFFVPQRSDVCDYIVQHLVRER 215
            |.:|..::||:..|   |..|...|...     ||..::.|:.||.:....|....:.||.....
Yeast   129 NRSLVTDLGAANFF---TPDHLDKHWDL-----VEAAKLFYIGGFHLTVSPDAIVKLGQHAKENS 185

  Fly   216 RRLALNLSAPYIVRKNHQAMMKLARAAFFLFGNRQEFEALAEAAGGFR------NVDELADHLLQ 274
            :...||.|||:|......|:.::...|..:..|..|.||..:|   |:      :::.:|..:::
Yeast   186 KPFVLNFSAPFIPHVFKDALARVLPYATVIIANESEAEAFCDA---FQLDCANTDLEAIAQRIVK 247

  Fly   275 -SGGTKVIFVTNGSAGVQVITNYVEELAPPGPVSFEDFRAQRVEQLVDATGAGDAFVAGFLHAWL 338
             |...|.:..|:|.....|:::......|..|:.        ..::||..||||||..||:....
Yeast   248 DSPVEKTVIFTHGVEPTVVVSSKGTSTYPVKPLD--------SSKIVDTNGAGDAFAGGFMAGLT 304

  Fly   339 EKRSLGECIRMASSVAAKVVTQVGCNLP 366
            :...|...|.|...:||..:.:||.:.|
Yeast   305 KGEDLETSIDMGQWLAALSIQEVGPSYP 332

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ady43ANP_651995.1 adenosine_kinase 28..366 CDD:238573 91/352 (26%)
PTZ00247 28..366 CDD:240328 91/352 (26%)
ADO1NP_012639.1 adenosine_kinase 5..332 CDD:238573 91/352 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S836
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45769
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.910

Return to query results.
Submit another query.