DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ady43A and MAK32

Sequence 1:NP_651995.1 Gene:Ady43A FlyBaseID:FBgn0026602 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_009946.1 Gene:MAK32 SGDID:S000000612 Length:363 Species:Saccharomyces cerevisiae

Alignment Length:190 Identity:38/191 (20%)
Similarity:74/191 (39%) Gaps:50/191 (26%)


  Fly   187 KQILYVEGFFVPQRSDVCDYIVQHLVRERRRLALNLSAPYIVRKNHQAMM--KLARAAFFLFG-N 248
            |.|:..|.|     .|:||:..|:.::.            ::::|...::  ..|..:..||| :
Yeast   168 KPIVIWEPF-----PDLCDFDHQNDIKS------------VMQRNDVTVILSPNAEESSRLFGLS 215

  Fly   249 RQEFEALAEAAGGFRNVDELADH----LLQSGGTKVIFVT----NGSAGVQVITNYVEELAPPGP 305
            .:|..:|.|........|:..|.    :|:.|....|.|:    ||.                  
Yeast   216 SKEPTSLEECLALAHRFDDFMDENNMCILRCGALGSISVSEKFKNGR------------------ 262

  Fly   306 VSFEDFRAQRVE---QLVDATGAGDAFVAGFLHAWLEKRSLGECIRMASSVAAKVVTQVG 362
             :::.|.|...:   :::|.||.|::|:.||..::...:||.......:..|..::.|.|
Yeast   263 -TYDHFPAYHFKTQSKVLDPTGGGNSFLGGFAVSYALTKSLDIASICGNIAAGAIIEQFG 321

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ady43ANP_651995.1 adenosine_kinase 28..366 CDD:238573 38/191 (20%)
PTZ00247 28..366 CDD:240328 38/191 (20%)
MAK32NP_009946.1 MAK32 13..344 CDD:238918 38/191 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.