DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ady43A and AT1G19600

Sequence 1:NP_651995.1 Gene:Ady43A FlyBaseID:FBgn0026602 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_173390.1 Gene:AT1G19600 AraportID:AT1G19600 Length:355 Species:Arabidopsis thaliana

Alignment Length:352 Identity:84/353 (24%)
Similarity:138/353 (39%) Gaps:73/353 (21%)


  Fly    38 LLDRLVQLEDPQLLERFGLELG-----SKGELDMEKLNQLAAEASESSRCLTNP-----GGSALN 92
            |:|.:..: |..||::...:.|     .|.||: ..|.:|.|..|.:      |     |||..|
plant    23 LIDNVAPV-DWSLLDQIPGDRGGSIAVQKDELE-HMLKELDAHISVA------PLKKMAGGSVTN 79

  Fly    93 TARILK-QLGTDALFFGAVGADKHAEELRQIIRDRGIEARLQTVEDAHTGQCVCLMYQD-NPTLY 155
            |.|.|. ..|......||.|.|:..:.....:...|:.......:...|.|||||:... |.|:.
plant    80 TVRGLSVGFGVATGIIGAYGDDEQGQLFVSNMGFSGVSISRLRKKKGSTAQCVCLVDDSGNRTMR 144

  Fly   156 ANIGASAQFEVQTLSHAVSHEGQSFLRPVERKQILYVEGFFVPQRSDVCDYIVQHLVRERRRLAL 220
            ..:.::.:.:...||.. ...|..:|  |.|..:|.::             ::|..:|..::..|
plant   145 PCLSSAVKIQADELSKE-DFTGSKWL--VLRYAVLNLQ-------------VIQAAIRFAKQEGL 193

  Fly   221 NLSAPYIVRKNHQAMMKLARAAFFLFGN-RQEFEALAEAAG---GFRNVDELADHLL--QSGGTK 279
            ::|              |..|:|.:..| :.|...|.|:..   .|.|.||.|:.|.  |..|.:
plant   194 SVS--------------LDLASFEMVRNSKSELRQLLESGNIDLCFANEDEAAELLRGEQEAGPE 244

  Fly   280 VIFVTNGSAGVQVITNY----VEELAPPGPVSFEDFRAQRVEQL-----VDATGAGDAFVAGFLH 335
                    |.::.:..:    |..|...|.::..|.....:..:     .|||||||.|.:|||:
plant   245 --------AALEFLGRHCRWAVVTLGSKGCIAKHDKEVVHISAIGETVATDATGAGDLFASGFLY 301

  Fly   336 AWLEKRSLGECIRMASSVAAKVVTQVG 362
            ..::..||.||.::.|.....|:..:|
plant   302 GLIKGLSLEECCKVGSCSGGSVIRALG 328

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ady43ANP_651995.1 adenosine_kinase 28..366 CDD:238573 84/353 (24%)
PTZ00247 28..366 CDD:240328 84/353 (24%)
AT1G19600NP_173390.1 PLN02379 1..355 CDD:178005 84/353 (24%)
adenosine_kinase 15..328 CDD:238573 83/351 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1226324at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.