DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ady43A and ADK2

Sequence 1:NP_651995.1 Gene:Ady43A FlyBaseID:FBgn0026602 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_195950.1 Gene:ADK2 AraportID:AT5G03300 Length:345 Species:Arabidopsis thaliana

Alignment Length:342 Identity:87/343 (25%)
Similarity:156/343 (45%) Gaps:27/343 (8%)


  Fly    35 GNVLLDRLVQLEDPQLLERFGLELGSKGELDMEKLNQLAAEASESSRCLTNPGGSALNTARI--- 96
            ||.||| :..:.|.:.|.::.::| :...|..:|...:..|.|.........||:..|:.::   
plant    15 GNPLLD-ISAVVDDEFLTKYDIKL-NNAILAEDKHLPMYDEMSSKFNVEYIAGGATQNSIKVAQW 77

  Fly    97 LKQLGTDALFFGAVGADKHAEELRQIIRDRGIEARLQTVEDAHTGQC-VCLMYQDNPTLYANIGA 160
            :.|:.....:.|::|.||:.|.:::.....|:.......|.|.||.| ||::..:. :|.||:.|
plant    78 MLQIPGATSYMGSIGKDKYGEAMKKDATAAGVNVHYYEDESAPTGTCGVCVVGGER-SLIANLSA 141

  Fly   161 SAQFEVQTLSHAVSHEGQSFLRPVERKQILYVEGFFVPQRSDVCDYIVQHLVRERRRLALNLSAP 225
            :..::|   .|....|..:.   ||:.:..|:.|||:....:....:.:|.....:...:|||||
plant   142 ANCYKV---DHLKKPENWAL---VEKAKFYYIAGFFLTVSPESIQLVSEHAAANNKVFTMNLSAP 200

  Fly   226 YIVRKNHQAMMKLARAAFFLFGNRQEFEALAEAAG-GFRNVDELA---DHLLQSGGT--KVIFVT 284
            :|.........|......|:|||..|....:...| ...:|:::|   ..|.::.||  :...:|
plant   201 FICEFFKDVQEKFLPYMDFVFGNETEARTFSRVHGWETEDVEQIAIKISQLPKATGTYKRTTVIT 265

  Fly   285 NGSAGVQVITNYVEELAPPGPVSFEDFRAQRVEQLVDATGAGDAFVAGFLHAWLEKRSLGECIRM 349
            .|:..|.|..:...:..|..|:.        .|:|||..|||||||.||:...::::|:.||::.
plant   266 QGADPVVVAEDGKVKKYPVIPLP--------KEKLVDTNGAGDAFVGGFMSQLVKEKSIEECVKA 322

  Fly   350 ASSVAAKVVTQVGCNLP 366
            ....:..|:.:.||..|
plant   323 GCYASNVVIQRSGCTYP 339

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ady43ANP_651995.1 adenosine_kinase 28..366 CDD:238573 86/341 (25%)
PTZ00247 28..366 CDD:240328 86/341 (25%)
ADK2NP_195950.1 PTZ00247 11..344 CDD:240328 87/343 (25%)
PLN02548 14..345 CDD:178163 87/343 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1226324at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45769
Phylome 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.