DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ady43A and NARA5

Sequence 1:NP_651995.1 Gene:Ady43A FlyBaseID:FBgn0026602 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_567780.1 Gene:NARA5 AraportID:AT4G27600 Length:471 Species:Arabidopsis thaliana

Alignment Length:385 Identity:84/386 (22%)
Similarity:145/386 (38%) Gaps:69/386 (18%)


  Fly    14 GNPPTDDTQ--------GAFHTPRK--VICFGNVLLDRLVQLEDPQLLERFGLELGSKGELDMEK 68
            ||...||.:        .:..:|.:  |:..|..::| ...:.|.:.|::.|||.|::..::.|:
plant    96 GNEDEDDDEFIQVHANNSSAASPERWDVLGLGQAMVD-FSGVVDDEFLKKLGLEKGTRKLINHEE 159

  Fly    69 LNQLAAEASESSRCLTNPGGSALNTARILKQLGTDAL--------FFGAVGADKHAEELRQIIRD 125
            ..:| .:|.:........|||..||...|.:||:.::        ..|::|.|.........:|.
plant   160 RGKL-LQAMDGCSYKAAAGGSLSNTLVALARLGSQSICDRPLNVAMAGSIGGDPLGSFYGTKLRR 223

  Fly   126 RGIEARLQTVEDAHTGQCVCLMYQD-NPTLYANIGASAQFEVQTLSHAVSHEGQSFLRPVERKQI 189
            ..:......::|..||..:.|...| ..|:.|..|.|          :|.:........:.:..:
plant   224 ANVNFLSAPIKDGTTGTVIVLTTPDAQRTMLAYQGTS----------SVVNYDSCLASLIAKTNV 278

  Fly   190 LYVEG--FFVPQRSDVCDYIVQHLVRERRRLALNLSAPYIVRKNHQAMMKL-ARAAFFLFGNRQE 251
            ..|||  |.:|..........:...|....:|:..|....:.:::.....: ...|..:|.|..|
plant   279 FVVEGYLFELPDTIRTITKACEEAHRNGALVAVTASDVSCIERHYDDFWDIVGNYADIVFANSDE 343

  Fly   252 ------FEALAEAAGGFRNVDELADHLLQSGGTKVIFVTNGS-AGVQVITNYVEELAPPGPVSFE 309
                  |.|........|.:......:..:.|      .||| .||:....|:    ||.|.   
plant   344 ARAFCHFSAEESPISATRYMSHFVPFVSVTDG------INGSYIGVKGEAIYI----PPSPC--- 395

  Fly   310 DFRAQRVEQLVDATGAGDAFVAGFLHAWL----EKRSLGECIRMASSVAAKVVTQVGCNL 365
                    ..||..|||||:.:|.|:..|    :.:.:|:   ||:::||.||.|.|..|
plant   396 --------VPVDTCGAGDAYASGILYGILRGVSDLKGMGD---MAATIAATVVGQQGTRL 444

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ady43ANP_651995.1 adenosine_kinase 28..366 CDD:238573 80/364 (22%)
PTZ00247 28..366 CDD:240328 80/364 (22%)
NARA5NP_567780.1 PLN02813 41..471 CDD:215434 84/386 (22%)
adenosine_kinase 120..445 CDD:238573 79/362 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1226324at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.