DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ady43A and Rbks

Sequence 1:NP_651995.1 Gene:Ady43A FlyBaseID:FBgn0026602 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_694876.1 Gene:Rbks MGIID:1918586 Length:323 Species:Mus musculus

Alignment Length:367 Identity:86/368 (23%)
Similarity:137/368 (37%) Gaps:82/368 (22%)


  Fly    14 GNP--PTDDTQGAFHTPRKVICFGNVLLDRLVQLED--PQLLE-----RFGLELGSKGELDMEKL 69
            |.|  |..:.:.|     .|:..|:.:.| ||.|..  |:..|     .|.:..|.||.....:.
Mouse     5 GEPGRPWQEEEAA-----AVVVVGSCMTD-LVSLTSRLPKTGETIHGHEFFIGFGGKGANQCVQA 63

  Fly    70 NQLAAEASESSRCLTNPGGSALNTARILKQLGTDALFFGAVGADKHAEELRQIIRDRGIEARLQT 134
            .:|.|:|:                  |:.::|.|:  ||    :.:.|.|:|  .....|...||
Mouse    64 ARLGAKAA------------------IVCKVGNDS--FG----NDYIENLKQ--NHISTEFTYQT 102

  Fly   135 VEDAHTGQCVCLMYQDNPTLYANI-GASAQFEVQTLSHAVSHEGQSFLRPVERKQILYVEGFFVP 198
             .||.||....::..:...:...: ||:.....:.|..|.|        .:.|.:::..:....|
Mouse   103 -RDAATGTASIIVNNEGQNIIVIVAGANLFLNSEDLKKAAS--------VISRAKVMICQLEISP 158

  Fly   199 QRSDVCDYIVQHLVRERRRLALNLSAPYIVRKNHQAMMKLARAAFFLFG----NRQEFEALAEAA 259
            ..|      ::.|...||.....|..|      ..||..|....:.|..    |..|.|.|...|
Mouse   159 AAS------LEALTMARRSGVKTLFNP------APAMADLDPQFYTLSSIFCCNESEAEILTGHA 211

  Fly   260 GGFRNVDELADHLLQSGGTKVIFVTNGSAGVQVITNYVEELAPPGP--VSFEDFRAQRVEQLVDA 322
            .........|..:|...|.:|:.:|.|::|..:::.     |.|.|  :..|..:|      ||.
Mouse   212 VSDPTTAGKAAMILLERGCQVVVITLGASGCVILSQ-----AEPVPKHIPTEAVKA------VDT 265

  Fly   323 TGAGDAFVA--GFLHAWLEKRSLGECIRMASSVAAKVVTQVG 362
            |||||:||.  .|..|:....||.|.::.::.:||..|...|
Mouse   266 TGAGDSFVGALAFYLAYYPNLSLEEMLKRSNFIAAVSVQATG 307

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ady43ANP_651995.1 adenosine_kinase 28..366 CDD:238573 82/352 (23%)
PTZ00247 28..366 CDD:240328 82/352 (23%)
RbksNP_694876.1 D_ribokin_bact 23..319 CDD:274000 81/345 (23%)
Substrate binding. {ECO:0000255|HAMAP-Rule:MF_03215} 26..28 0/2 (0%)
Substrate binding. {ECO:0000255|HAMAP-Rule:MF_03215} 54..58 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.