DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ady43A and RBKS

Sequence 1:NP_651995.1 Gene:Ady43A FlyBaseID:FBgn0026602 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_071411.1 Gene:RBKS HGNCID:30325 Length:322 Species:Homo sapiens

Alignment Length:350 Identity:82/350 (23%)
Similarity:133/350 (38%) Gaps:79/350 (23%)


  Fly    31 VICFGNVLLDRLVQLED--PQLLE-----RFGLELGSKGELDMEKLNQLAAEASESSRCLTNPGG 88
            |:..|:.:.| ||.|..  |:..|     :|.:..|.||.....:..:|.|..|           
Human    18 VVVVGSCMTD-LVSLTSRLPKTGETIHGHKFFIGFGGKGANQCVQAARLGAMTS----------- 70

  Fly    89 SALNTARILKQLGTDALFFGAVGADKHAEELRQIIRDRGIEARLQTVEDAHTGQCVCLMYQDNPT 153
                   ::.::|.|:  ||    :.:.|.|:|  .|...|...|| :||.||....::..:...
Human    71 -------MVCKVGKDS--FG----NDYIENLKQ--NDISTEFTYQT-KDAATGTASIIVNNEGQN 119

  Fly   154 LYANI-GASAQFEVQTLSHAVSHEGQSFLRPVERKQILYVEGFFVPQRSDVCDYIVQHLVRERRR 217
            :...: ||:.....:.|..|.:        .:.|.:::..:....|..|      ::.|...||.
Human   120 IIVIVAGANLLLNTEDLRAAAN--------VISRAKVMVCQLEITPATS------LEALTMARRS 170

  Fly   218 LALNL--SAPYIVRKNHQAMMKLARAAFFLFG-----NRQEFEALAE-AAGGFRNVDELADHLLQ 274
            ....|  .||.|...:.|         |:...     |..|.|.|.. ..|...:..|.|..||:
Human   171 GVKTLFNPAPAIADLDPQ---------FYTLSDVFCCNESEAEILTGLTVGSAADAGEAALVLLK 226

  Fly   275 SGGTKVIFVTNGSAGVQVITNYVEELAPPGPVSFEDFRAQRVEQLVDATGAGDAFVA--GFLHAW 337
            . |.:|:.:|.|:.|..|::....|   |..:..|..:|      ||.|||||:||.  .|..|:
Human   227 R-GCQVVIITLGAEGCVVLSQTEPE---PKHIPTEKVKA------VDTTGAGDSFVGALAFYLAY 281

  Fly   338 LEKRSLGECIRMASSVAAKVVTQVG 362
            ....||.:.:..::.:||..|...|
Human   282 YPNLSLEDMLNRSNFIAAVSVQAAG 306

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ady43ANP_651995.1 adenosine_kinase 28..366 CDD:238573 82/350 (23%)
PTZ00247 28..366 CDD:240328 82/350 (23%)
RBKSNP_071411.1 D_ribokin_bact 22..318 CDD:274000 81/346 (23%)
Substrate binding. {ECO:0000250|UniProtKB:P0A9J6, ECO:0000255|HAMAP-Rule:MF_03215} 25..27 0/2 (0%)
Substrate binding. {ECO:0000250|UniProtKB:P0A9J6, ECO:0000255|HAMAP-Rule:MF_03215} 53..57 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.