DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ady43A and rbks

Sequence 1:NP_651995.1 Gene:Ady43A FlyBaseID:FBgn0026602 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001011336.1 Gene:rbks XenbaseID:XB-GENE-956320 Length:310 Species:Xenopus tropicalis

Alignment Length:368 Identity:74/369 (20%)
Similarity:120/369 (33%) Gaps:108/369 (29%)


  Fly    27 TPRKVICFGNVLLDRLVQLEDPQLLERFGLELGSKGELDMEKLNQLAAEASESSRCLTNPGGSAL 91
            || :||..|:.:.| ||.: .|:|.:                    |.|....|:.....||...
 Frog     3 TP-QVIVVGSCMTD-LVSV-TPRLPK--------------------AGETIHGSKFFIGFGGKGA 44

  Fly    92 NTARILKQLGTDALFFGAVGADKHAEELRQIIRDRGIEARL--QTVEDAHTGQCVCLMYQDNPTL 154
            |......:||........||.|....:.........:....  ||.|.|.....:.:..:....:
 Frog    45 NQCIQAARLGVKTSMVCKVGKDSFGNDYIANFTKNHVSTDFVGQTAEAATGAASIIVNAEGQNAI 109

  Fly   155 YANIGASAQFEVQTLSHAVSHEGQSFLRPVERKQILYVEGFFVPQRSDVCDYIVQHLVRERRRLA 219
            ....||:...:.:.|..|.:        .:.|..:|            ||...:        |..
 Frog   110 VIVAGANLLLDSEDLKRAST--------AISRANVL------------VCQLEI--------RPE 146

  Fly   220 LNLSAPYIVRKNHQAMMKLARAA------------------FFLFG-----NRQEFEALAEAAGG 261
            ::|.|           :|:||::                  ||...     |..|.|.|..|...
 Frog   147 ISLEA-----------LKMARSSGVKTIFNPAPAVAQLDPEFFTHSDIFCCNESEAEILTAAPVN 200

  Fly   262 FRNVDELADHLLQSGGTKVIFVTNGSAGVQVITNYVEELAPPGPVSFEDFRAQRVEQLVDATGAG 326
            .......|..||...|.||:.:|.|..|..:::   :|...|..:|....:|      ||:||||
 Frog   201 SPQEAGTAGALLLEKGCKVVIITLGGEGCVILS---QEDPTPKHISTNKVKA------VDSTGAG 256

  Fly   327 DAFV-------AGFLHAWLEKRSLGECIRMASSVAAKVVTQVG 362
            |:||       |.:.|..:|     :.::.::.:|:..|...|
 Frog   257 DSFVGALAYYMALYPHLCME-----DMVKRSNYIASVSVQTAG 294

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ady43ANP_651995.1 adenosine_kinase 28..366 CDD:238573 73/368 (20%)
PTZ00247 28..366 CDD:240328 73/368 (20%)
rbksNP_001011336.1 D_ribokin_bact 10..306 CDD:274000 70/361 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.