DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ady43A and rbks

Sequence 1:NP_651995.1 Gene:Ady43A FlyBaseID:FBgn0026602 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001002117.1 Gene:rbks ZFINID:ZDB-GENE-040625-112 Length:311 Species:Danio rerio

Alignment Length:312 Identity:72/313 (23%)
Similarity:104/313 (33%) Gaps:65/313 (21%)


  Fly    73 AAEASESSRCLTNPGGSALNTARILKQLGTDALFFGAVGADKHAEELRQIIRDRGIE-ARLQTVE 136
            |.|.....|.....||...|......::|........||.|....:..|..::.||. |.::..|
Zfish    27 AGETIHGHRFFIGFGGKGANQCVQAARMGAKTAMVCKVGRDVFGNDYIQNFKNNGISTAYVEQTE 91

  Fly   137 DAHTGQCVCLMYQDNPTLYANI-GAS---AQFEVQTLSHAVSHEGQSFLRPVERKQILYVEGFFV 197
            .|.||....::..........: ||:   .|.|:|....|:.:           .::|..:....
Zfish    92 KAATGAASIIVNDTGENAIVIVAGANLLLGQEELQRAQSAIIN-----------AKVLVCQLEIS 145

  Fly   198 PQRSDVCDYIVQHLVRERRRLALNLSAPYIVRKNH-QAMMKLARAAFFLFG-----------NRQ 250
            |..|                    |.|..:.|:|| :.:...|.|..:|..           |..
Zfish   146 PDAS--------------------LQALKMARENHVKTIFNPAPAIAYLDSDFYKASDVFCCNES 190

  Fly   251 EFEALAE-AAGGFRNVDELADHLLQSGGTKVIFVTNGSAGVQVI--TNYVEELAPPGPVSFEDFR 312
            |.|.|.. :.....:..::...||..|...|| ||.||.|..|.  ||...:..|...|:     
Zfish   191 EAEMLTGLSVTSVEDACQVGLELLNKGCASVI-VTLGSQGCVVCQSTNKTPKHIPTIEVT----- 249

  Fly   313 AQRVEQLVDATGAGDAFVA--GFLHAWLEKRSLGECIRMASSVAAKVVTQVG 362
                  ..|.|||||:|:.  .|..|......:.|..|.|:.|||..|..||
Zfish   250 ------AADTTGAGDSFIGALAFYMAHYPAMPMEEMARRANLVAAVSVQTVG 295

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ady43ANP_651995.1 adenosine_kinase 28..366 CDD:238573 72/313 (23%)
PTZ00247 28..366 CDD:240328 72/313 (23%)
rbksNP_001002117.1 D_ribokin_bact 11..307 CDD:274000 72/313 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.