DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ady43A and CG3809

Sequence 1:NP_651995.1 Gene:Ady43A FlyBaseID:FBgn0026602 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_731676.2 Gene:CG3809 FlyBaseID:FBgn0037995 Length:396 Species:Drosophila melanogaster

Alignment Length:382 Identity:95/383 (25%)
Similarity:167/383 (44%) Gaps:49/383 (13%)


  Fly    15 NPPTDD--TQGAFHTPRKVIC-----------------FGNVLLDRLVQLEDPQLLERFGLELGS 60
            :||...  :.|.|.|..:..|                 |||.|||....:||..:||::|||..:
  Fly    22 HPPAFQHFSGGVFRTSFRSFCDCQEHRRMDLPEGILMGFGNPLLDITCTVEDNVILEKYGLEANA 86

  Fly    61 KGELDMEKLNQLAAEASESSRCLTNPGGSALNTARILK---QLGTDALFFGAVGADKHAEELRQI 122
            ....| ||.:.|..|.......:.:.||:..|:.||.:   |....|:|.|:||.||..:.:.:.
  Fly    87 AIIAD-EKHDALFDELMNMENVIYSAGGACQNSMRIFQWIVQTPFRAVFIGSVGKDKLGDRIEKR 150

  Fly   123 IRDRGIEARLQTVEDAHTGQCVCLMYQDNPTLYANIGASAQFEVQTLSHAVSHEGQSFLRPVERK 187
            .:..|:....|..|:..||.|..::...|.:|.||:||::.|....:      :....:..::|.
  Fly   151 AKSDGLLTLYQLKEELPTGSCAVIINGPNRSLVANLGAASLFSDDWI------DEDDNICALDRA 209

  Fly   188 QILYVEGFFVPQRSDVCDYIVQHLVR----ERRRLALNLSAPYIVRKNHQAMMKLARAAFFLFGN 248
            :..|..|||:.    ||...|:.:.|    ..|.:.||.||.::::...:|:..:.:....:..|
  Fly   210 EYFYFTGFFLA----VCPPAVERVARMCCETNRIMILNFSAVFVLQMQKEALGNILQYVDIIICN 270

  Fly   249 RQEFEALAEAAG-GFRNVDELADHLLQ----SGGTKVIFVTNGSAGVQVITNYVEELAPPGPVSF 308
            ::|..|.::... ..:|:.|:...|.|    :...:::.:|:....|.|..:....|..|.|   
  Fly   271 KEEAIAFSDTNDWKTKNIFEIGSRLQQMPKENTRPRLVMITDAVCPVLVFQDNDRVLEYPVP--- 332

  Fly   309 EDFRAQRVEQLVDATGAGDAFVAGFLHAWLEKRSLGECIRMASSVAAKVVTQVGCNL 365
                ..:..::.|..|.|||||.|||..::::..|..|||.....:.:|:..||..:
  Fly   333 ----PVKQGEIFDTNGCGDAFVGGFLAMYVQRMPLDYCIRTGIFASQQVLHVVGVQI 385

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ady43ANP_651995.1 adenosine_kinase 28..366 CDD:238573 90/368 (24%)
PTZ00247 28..366 CDD:240328 90/368 (24%)
CG3809NP_731676.2 PTZ00247 50..392 CDD:240328 89/355 (25%)
adenosine_kinase 54..382 CDD:238573 88/346 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0524
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S836
OrthoDB 1 1.010 D1226324at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR45769
RoundUp 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.