DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ady43A and AdenoK

Sequence 1:NP_651995.1 Gene:Ady43A FlyBaseID:FBgn0026602 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001287054.1 Gene:AdenoK FlyBaseID:FBgn0036337 Length:345 Species:Drosophila melanogaster

Alignment Length:342 Identity:95/343 (28%)
Similarity:157/343 (46%) Gaps:33/343 (10%)


  Fly    35 GNVLLD--RLVQLEDPQLLERFGLELGSKGELDMEKLNQLAAEASESSRCLTNPGGSALNTAR-- 95
            ||.|||  .:|.|   ..|:::.:. .....|..::...:..|..|..:.....|||..|:.|  
  Fly    14 GNPLLDISAVVPL---NFLQKYSMN-EDDAILAEDRHMPIYGELVEGYQAEFLAGGSVQNSLRIA 74

  Fly    96 --ILKQLGTDALFFGAVGADKHAEELRQIIRDRGIEARLQTVEDAHTGQCVCLMYQDNPTLYANI 158
              ||:|... |:|||.||.|::|..|::..:..|::...|..:|..||.|..|:...:.:|.||:
  Fly    75 QWILRQPRV-AVFFGCVGEDRYANILKEKAQAAGLDVHYQVKKDVPTGTCAVLITGTHRSLCANL 138

  Fly   159 GASAQFEVQTLSHAVSHEGQSFLRPVERKQILYVEGFFVPQRSDVCDYIVQHLVRERRRLALNLS 223
            .|:..|   |:.|......::.   |:..|..|:.|||:.........:......::|...:|||
  Fly   139 AAANNF---TIDHLEEPSNKAL---VDNAQYYYISGFFLTVNPPSIMQVAATAHAKQRPFLMNLS 197

  Fly   224 APYIVRKNHQAMMKLARAAFFLFGNRQEFEALAEA----AGGFRNVDELADHLLQSGGT--KVIF 282
            ||:|.:.....::........:|||..|.:|.|||    :|..|.:.:....:.:...|  ::..
  Fly   198 APFISQFYMAPLLAALPYVDIIFGNEAEAQAFAEAQQWPSGDLREIGKRLVAMEKKNPTRPRIAI 262

  Fly   283 VTNGSAGVQVI-TNYVEELAPPGPVSFEDFRAQRVEQLVDATGAGDAFVAGFLHAWLEKRSLGEC 346
            :|.|...|.:| .:.|:|.    ||:     ...|.::||..|||||||.|||..:::.:||..|
  Fly   263 LTQGCDPVLLIQQDSVQEF----PVT-----KLAVHEIVDTNGAGDAFVGGFLSQFVQGKSLDVC 318

  Fly   347 IRMASSVAAKVVTQVGC 363
            ||..:..|..::...||
  Fly   319 IRCGNYAAGHIIKNPGC 335

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ady43ANP_651995.1 adenosine_kinase 28..366 CDD:238573 95/343 (28%)
PTZ00247 28..366 CDD:240328 95/343 (28%)
AdenoKNP_001287054.1 PTZ00247 10..343 CDD:240328 95/343 (28%)
ribokinase_pfkB_like 14..343 CDD:294126 95/343 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0524
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S836
OrthoDB 1 1.010 D1226324at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR45769
RoundUp 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.