DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ady43A and adka

Sequence 1:NP_651995.1 Gene:Ady43A FlyBaseID:FBgn0026602 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_997956.1 Gene:adka ZFINID:ZDB-GENE-030425-3 Length:359 Species:Danio rerio

Alignment Length:348 Identity:93/349 (27%)
Similarity:156/349 (45%) Gaps:37/349 (11%)


  Fly    35 GNVLLDRLVQLEDPQLLERFGLELGSKGELDMEKLNQLAAEASESSRCLTNPGGSALNTARILK- 98
            ||.||| :..:.|...|:::||:...: .|..:|..::..|..:..:.....||:..|:.::.: 
Zfish    27 GNPLLD-ICAVVDKDFLDKYGLKPNDQ-ILAEDKHKEMFEEMVKKFKVEYRAGGATQNSVKVAQW 89

  Fly    99 ------QLGTDALFFGAVGADKHAEELRQIIRDRGIEARLQTVEDAHTGQCVCLMYQDNPTLYAN 157
                  .:||   |||.:|.||..:.|::...:..::|......:..||.|...:..||.:|.||
Zfish    90 MIQEPHNVGT---FFGCIGKDKFGKILKEKAEEAHVDAHYYEQSEEPTGSCAACITGDNRSLVAN 151

  Fly   158 IGASAQFEVQTLSHAVSHEGQSFLRPVERKQILYVEGFFVPQRSDVCDYIVQHLVRERRRLALNL 222
            :.|:..::.:  .|....|....   ||:.|:.|:.|||:....:....:.:|.....:...|||
Zfish   152 LAAANCYKKE--KHLDLEENWKL---VEKAQVYYIAGFFLTVSLESILKVAKHASENNKIFCLNL 211

  Fly   223 SAPYIVRKNHQAMMKLARAAFFLFGNRQEFEALAEAAG-GFRNVDELADHLLQS------GGTKV 280
            |||:|.....:|:||:......||||..|..|.|...| ...:::|:|.. .||      ...::
Zfish   212 SAPFICEFFKEALMKVMPYVDILFGNETEAAAFAREQGFETEDIEEIAKK-AQSLPKENKKRQRI 275

  Fly   281 IFVTNGSAGVQVITNYVEELAPPGPVSFEDFRAQRVEQ--LVDATGAGDAFVAGFLHAWLEKRSL 343
            :..|.|..|.        .:|....|  |.|....::|  :||..|||||||.|||...::.::.
Zfish   276 VVFTQGKEGT--------VMAKGDKV--ETFPVLEIDQSEIVDTNGAGDAFVGGFLSQLVQDKTF 330

  Fly   344 GECIRMASSVAAKVVTQVGCNLP 366
            .:|||.....|..::...||..|
Zfish   331 EQCIRAGHYAANVIIRHAGCTFP 353

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ady43ANP_651995.1 adenosine_kinase 28..366 CDD:238573 92/347 (27%)
PTZ00247 28..366 CDD:240328 92/347 (27%)
adkaNP_997956.1 PTZ00247 23..358 CDD:240328 93/349 (27%)
ribokinase_pfkB_like 26..358 CDD:294126 93/349 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1226324at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45769
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.