DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ady43A and adkb

Sequence 1:NP_651995.1 Gene:Ady43A FlyBaseID:FBgn0026602 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_942097.1 Gene:adkb ZFINID:ZDB-GENE-030131-948 Length:345 Species:Danio rerio

Alignment Length:344 Identity:96/345 (28%)
Similarity:153/345 (44%) Gaps:29/345 (8%)


  Fly    35 GNVLLDRLVQLEDPQLLERFGLELGSKGELDMEKLNQLAAEASESSRCLTNPGGSALNTARILKQ 99
            ||.||| :..:.|...|:::||:...: .|..||...|..|....|:...:.|||..|:.:|.:.
Zfish    13 GNPLLD-ISAVVDKDFLDKYGLKPNDQ-ILAEEKHKALFDEIVNKSKVEYHAGGSTQNSVKIAQW 75

  Fly   100 LGTD----ALFFGAVGADKHAEELRQIIRDRGIEARLQTVEDAHTGQCVCLMYQDNPTLYANIGA 160
            :..:    |.|||.:|.|...|.|:|...:..::|.........||.|...:..||.:|.||:.|
Zfish    76 MIQEPHKVATFFGCIGTDHFGEILKQKAAEAHVDAHYYEQNQEPTGTCAACITGDNRSLVANLAA 140

  Fly   161 SAQFEVQTLSHAVSHEGQSFLRPVERKQILYVEGFFVPQRSDVCDYIVQHLVRERRRLALNLSAP 225
            :..:..:  .|.......|.   ||:.::.|:.|||:....|....:.:|.....:...||||||
Zfish   141 ANCYNKE--KHLDIDRNWSL---VEKARVYYIAGFFLTVSPDSILKVAKHASDNNKIFGLNLSAP 200

  Fly   226 YIVRKNHQAMMKLARAAFFLFGNRQEFEALAEAAGGFRNVD--ELADHLLQS------GGTKVIF 282
            :|.:.:.:.:||:......:|||..|....|:.. ||...|  |:| |.:|:      ...:::.
Zfish   201 FISQFSKEPLMKVLPYVDIIFGNETEAATFAKEQ-GFETEDIAEIA-HRVQNLPKVNKNRQRIVV 263

  Fly   283 VTNGSAGVQVITNYVEELAPPGPVSFEDFRAQRVEQLVDATGAGDAFVAGFLHAWLEKRSLGECI 347
            .|.|............::.|...:...|        :||..|||||||.|||.|.::.:.|.|||
Zfish   264 FTQGREDTVATVGDKVKMFPVLDIDQND--------IVDTNGAGDAFVGGFLSALVQDQPLEECI 320

  Fly   348 RMASSVAAKVVTQVGCNLP 366
            |.....|..::.:.||..|
Zfish   321 RAGHYAAHVIIRRSGCTFP 339

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ady43ANP_651995.1 adenosine_kinase 28..366 CDD:238573 95/343 (28%)
PTZ00247 28..366 CDD:240328 95/343 (28%)
adkbNP_942097.1 PTZ00247 2..344 CDD:240328 96/345 (28%)
ribokinase_pfkB_like 12..344 CDD:294126 96/345 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1226324at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45769
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.