DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ady43A and adkb

DIOPT Version :9

Sequence 1:NP_651995.1 Gene:Ady43A / 44750 FlyBaseID:FBgn0026602 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_942097.1 Gene:adkb / 322229 ZFINID:ZDB-GENE-030131-948 Length:345 Species:Danio rerio


Alignment Length:344 Identity:96/344 - (27%)
Similarity:153/344 - (44%) Gaps:29/344 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GNVLLDRLVQLEDPQLLERFGLELGSKGELDMEKLNQLAAEASESSRCLTNPGGSALNTARILKQ 99
            ||.||| :..:.|...|:::||:...: .|..||...|..|....|:...:.|||..|:.:|.:.
Zfish    13 GNPLLD-ISAVVDKDFLDKYGLKPNDQ-ILAEEKHKALFDEIVNKSKVEYHAGGSTQNSVKIAQW 75

  Fly   100 LGTD----ALFFGAVGADKHAEELRQIIRDRGIEARLQTVEDAHTGQCVCLMYQDNPTLYANIGA 160
            :..:    |.|||.:|.|...|.|:|...:..::|.........||.|...:..||.:|.||:.|
Zfish    76 MIQEPHKVATFFGCIGTDHFGEILKQKAAEAHVDAHYYEQNQEPTGTCAACITGDNRSLVANLAA 140

  Fly   161 SAQFEVQTLSHAVSHEGQSFLRPVERKQILYVEGFFVPQRSDVCDYIVQHLVRERRRLALNLSAP 225
            :..:..:  .|.......|.   ||:.::.|:.|||:....|....:.:|.....:...||||||
Zfish   141 ANCYNKE--KHLDIDRNWSL---VEKARVYYIAGFFLTVSPDSILKVAKHASDNNKIFGLNLSAP 200

  Fly   226 YIVRKNHQAMMKLARAAFFLFGNRQEFEALAEAAGGFRNVD--ELADHLLQS------GGTKVIF 282
            :|.:.:.:.:||:......:|||..|....|:.. ||...|  |:| |.:|:      ...:::.
Zfish   201 FISQFSKEPLMKVLPYVDIIFGNETEAATFAKEQ-GFETEDIAEIA-HRVQNLPKVNKNRQRIVV 263

  Fly   283 VTNGSAGVQVITNYVEELAPPGPVSFEDFRAQRVEQLVDATGAGDAFVAGFLHAWLEKRSLGECI 347
            .|.|............::.|...:...|        :||..|||||||.|||.|.::.:.|.|||
Zfish   264 FTQGREDTVATVGDKVKMFPVLDIDQND--------IVDTNGAGDAFVGGFLSALVQDQPLEECI 320

  Fly   348 RMASSVAAKVVTQVGCNLP 366
            |.....|..::.:.||..|
Zfish   321 RAGHYAAHVIIRRSGCTFP 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ady43ANP_651995.1 adenosine_kinase 28..366 CDD:238573 95/342 (28%)
PTZ00247 28..366 CDD:240328 95/342 (28%)
adkbNP_942097.1 PTZ00247 2..344 CDD:240328 96/344 (28%)
ribokinase_pfkB_like 12..344 CDD:294126 96/344 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1226324at2759
OrthoFinder 1 1.000 - - FOG0003751
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100649
Panther 1 1.100 - - O PTHR45769
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2162
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.