DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ady43A and CG13369

Sequence 1:NP_651995.1 Gene:Ady43A FlyBaseID:FBgn0026602 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_569850.1 Gene:CG13369 FlyBaseID:FBgn0025640 Length:304 Species:Drosophila melanogaster

Alignment Length:369 Identity:90/370 (24%)
Similarity:132/370 (36%) Gaps:113/370 (31%)


  Fly    30 KVICFGNVLLD------RLVQLEDPQLLERFGLELGSKGELDMEKLNQLAAEASESSRCLTNPGG 88
            :|:.||:.::|      ||.:..:.....||.:..|.||      .||..|.|.:.||       
  Fly     5 EVLVFGSAIIDFISYTTRLPKAGETLHGHRFQIGYGGKG------ANQCVAAARQGSR------- 56

  Fly    89 SALNTARILKQLGTDALFFGAVGADKHAEELRQIIRDRGIEARLQTVEDAHTGQCVCLMYQDNPT 153
                ||.:.| ||.|.  ||       ::.||.:..:|.....::.:.:..||            
  Fly    57 ----TALVAK-LGADT--FG-------SDYLRHLREERVNVNHVEQLAEETTG------------ 95

  Fly   154 LYANIGASAQFEVQTLSHAVSHEGQSFLRPVERKQILYVEGFFVPQRSDVCDY-IVQHLVRERRR 217
                   .||.       |||..|::        .|:.|.|  ...|...||. ..:.|.:|.:.
  Fly    96 -------VAQI-------AVSDGGEN--------NIIIVVG--ANNRLSSCDVSSAKALFQEAKV 136

  Fly   218 LALNLSAPYIVRKNHQAM-----MKLARAAFFLFGNRQEFEALA--------EAA--------GG 261
            |...|..|  |.....|:     :.:..||..:.....|...||        |||        |.
  Fly   137 LVCQLETP--VEATLTALRAFRGVSIVNAAPAMADTPPELLQLASIFCVNESEAALMTQMPDIGN 199

  Fly   262 FRNVDELADHLLQSGGTKVIFVTN------GSAGVQVITNYVEELAPPGPVSFEDFRAQRVEQLV 320
            ..:.::....|:.:|...||....      |||..:.:..:|  .||..|          .|::|
  Fly   200 IEHAEDAVGKLIAAGANTVIITLGKLGAVFGSADSKGVCQHV--AAPSVP----------PEKVV 252

  Fly   321 DATGAGDAFVAGFLH--AWLEKRSLGECIRMASSVAAKVVTQVG 362
            |.|||||||:....|  |....|.|.|.|..|.:||::.|...|
  Fly   253 DTTGAGDAFIGALAHNLARHPTRKLEEHIAAACAVASQSVQLPG 296

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ady43ANP_651995.1 adenosine_kinase 28..366 CDD:238573 90/370 (24%)
PTZ00247 28..366 CDD:240328 90/370 (24%)
CG13369NP_569850.1 ribokinase 6..303 CDD:238579 90/369 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0524
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.