DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ady43A and SPCC338.14

Sequence 1:NP_651995.1 Gene:Ady43A FlyBaseID:FBgn0026602 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_588154.1 Gene:SPCC338.14 PomBaseID:SPCC338.14 Length:340 Species:Schizosaccharomyces pombe

Alignment Length:358 Identity:95/359 (26%)
Similarity:158/359 (44%) Gaps:54/359 (15%)


  Fly    32 ICFG--NVLLDRLVQLEDPQLLERFGLELGSKGELDMEKLNQLAAEASESSR------CLT-NPG 87
            |.||  |.|||..|..| ...||::||           |.|. |..||||..      |:: :.|
pombe     5 ILFGLENPLLDYYVGGE-TATLEKYGL-----------KSND-AVLASESQMGIYKEPCVSYSAG 56

  Fly    88 GSALNTARILKQL--GTDALFFGAVGADKHAEELRQIIRDRGIEARLQTVEDAHTGQCVCLMYQD 150
            |:|.|:.|..:.:  ....:|.|.||.||.|:.|.:.....|:.:.........||.|..::..:
pombe    57 GAAQNSCRAAQYVLPPNSTVFAGCVGQDKFADMLLESNEKAGLRSEFSVDPTTPTGVCAVVLSNN 121

  Fly   151 NP--TLYANIGASAQFEVQTLSHAVSHEGQSFLRPVERKQILYVEGFF--VPQRSDVCDYIVQHL 211
            |.  :|..|:||:..::::.|      :..:..:.||..:::||.||.  |...|.:|  :.||.
pombe   122 NKNRSLCTNLGAANNYKLKDL------QQPNVWKFVEEAKVIYVGGFHLTVSPESMLC--LAQHA 178

  Fly   212 VRERRRLALNLSAPYIVRKNHQAMMKLARAAFFLFGNRQEFEALAEAAG-GFRNVDELADHL--- 272
            ....:...:|||||::.:...:.|..:.....::.||..|..:..|..| ...:|.|:|..|   
pombe   179 NENNKPYIMNLSAPFLSQFFKEQMDSVIPYCDYVIGNEAEILSYGENHGIKSTDVQEIALALSSV 243

  Fly   273 --LQSGGTKVIFVTNGSAGVQVITNYVEELAPPGPVSFEDFRAQRV--EQLVDATGAGDAFVAGF 333
              :....|:|:.:|.|:....|        |..|.|:  .::..||  |::||..||||||..||
pombe   244 EKVNKKRTRVVVITQGADATIV--------AKDGKVT--TYKPNRVPSEEIVDTNGAGDAFAGGF 298

  Fly   334 LHAWLEKRSLGECIRMASSVAAKVVTQVGCNLP 366
            :.|..:.:.:...:.:...:..:.:...|..||
pombe   299 IAALSQGQGIDYAVTLGHWLGQECIKVSGTTLP 331

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ady43ANP_651995.1 adenosine_kinase 28..366 CDD:238573 94/357 (26%)
PTZ00247 28..366 CDD:240328 94/357 (26%)
SPCC338.14NP_588154.1 PTZ00247 1..331 CDD:240328 94/357 (26%)
ribokinase_pfkB_like 11..337 CDD:294126 92/353 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45769
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
22.060

Return to query results.
Submit another query.