DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ady43A and R07H5.8

Sequence 1:NP_651995.1 Gene:Ady43A FlyBaseID:FBgn0026602 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_502104.1 Gene:R07H5.8 WormBaseID:WBGene00011128 Length:342 Species:Caenorhabditis elegans

Alignment Length:352 Identity:99/353 (28%)
Similarity:155/353 (44%) Gaps:50/353 (14%)


  Fly    36 NVLLDRLVQLEDPQLLERFGLELGSKGELDMEKLNQLAAEASESSRCLTNPGGSALNTARILKQL 100
            |.|||....:| ...|:::||:.......| :|.|.:..|.:...:....|||:|.|:.|:.:.:
 Worm    14 NPLLDIQTTVE-KAFLDKWGLKENDAILCD-DKHNDMFTELTRDFKVEYIPGGAAQNSLRVAQWI 76

  Fly   101 ---GTDALFFGAVGADKHAEELRQIIRDRGIEARLQTVEDAHTGQCVCLMYQDNPTLYANIGASA 162
               ....:||||||.|::.:.|....::.|:....|..|...||.|..|:...:.:|.|::.|:.
 Worm    77 LNAPNRTVFFGAVGKDQYGDLLASKAKEAGVNVHYQINETVKTGTCAALINGTHRSLCAHLAAAN 141

  Fly   163 QFEVQTLSHAVSHEGQSFLRPVERKQILYVEGFFVPQRSDVCD----YIVQHLVRERRRLALNLS 223
            .|   |..|....|.|..   :|:.:..||.|||:    .||.    .:..|.....:...||||
 Worm   142 TF---TQDHLQKEENQKI---IEQAKYFYVTGFFI----TVCPPAILQLASHSAEFNKTFTLNLS 196

  Fly   224 APYIVRKNHQAMMKLARAAFFLFGNRQEFEALAEAAGGFRN-VDELA--DHLLQSGGTK---VIF 282
            ||:|.:.....:.::......||||..|..|.|:|.|.... |.|:|  ...|....||   |:|
 Worm   197 APFISQFFFDKLSEIIPLVDVLFGNEDEAAAFAKANGWETTCVKEIALKAAALPKKSTKPRLVVF 261

  Fly   283 VTNGSAGVQVITNYVEELAPPGPV------SFEDFRAQRV--EQLVDATGAGDAFVAGFLHAWLE 339
             |.|                |.||      ...:|...|:  |::||..|||||||.|||..:::
 Worm   262 -TQG----------------PEPVIVVEGDKVTEFPVTRLPKEEIVDTNGAGDAFVGGFLSQFIQ 309

  Fly   340 KRSLGECIRMASSVAAKVVTQVGCNLP 366
            .:.:...:...|..|.:::.:.||.:|
 Worm   310 GKGVEASVTCGSYAAQEIIKKHGCTVP 336

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ady43ANP_651995.1 adenosine_kinase 28..366 CDD:238573 98/351 (28%)
PTZ00247 28..366 CDD:240328 98/351 (28%)
R07H5.8NP_502104.1 PTZ00247 9..339 CDD:240328 99/353 (28%)
ribokinase_pfkB_like 12..341 CDD:294126 99/353 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S836
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1226324at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45769
Phylome 1 0.910 0.661 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.