DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ady43A and F07A11.5

Sequence 1:NP_651995.1 Gene:Ady43A FlyBaseID:FBgn0026602 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_496483.2 Gene:F07A11.5 WormBaseID:WBGene00008548 Length:314 Species:Caenorhabditis elegans

Alignment Length:363 Identity:64/364 (18%)
Similarity:121/364 (33%) Gaps:103/364 (28%)


  Fly    29 RKVICFGNVLLDRLVQLEDP-----QLLERFGLELGSKGELDMEKLNQLAAEASESSRCLTNPGG 88
            :|::.||:::.| ||...|.     :.:.....:|||                          ||
 Worm     6 QKIVVFGSIVQD-LVSYTDSFPRPGESVRGHNFKLGS--------------------------GG 43

  Fly    89 SALNTARILKQLGTDALFFGAVGADKHAEELRQIIRDRGIEARLQTVEDAHTGQCVCLMYQDNPT 153
            ...|.|....:||.:....|.||.|...:...:.:...|::.           .||         
 Worm    44 KGANQAVAAARLGINVSMIGMVGEDMFGDSNIKDLSSNGVDT-----------SCV--------- 88

  Fly   154 LYANIGASAQFEVQTLSHAVSHEGQSFLRPVERKQILYVEGFFVPQRSDVCDYIVQHLVRERRRL 218
                 |.:.:....|.:..|:.||::        .|:...|..:....::.|.....:...:   
 Worm    89 -----GRTKKTHTATATITVNKEGEN--------NIVVTLGANLEMSPEIADANSSKIAGSK--- 137

  Fly   219 ALNLSAPYIVRKNHQAMMKLARA-----------------------AFFLFGNRQEFEALAE-AA 259
             :.:....|..|.::...::||:                       ...:..|..|.|.:.. |.
 Worm   138 -MVICQGEIDEKGNRRAFEIARSHGVTTFLNPAPGDPNMDKTILELVDIICTNENEAEFITGIAQ 201

  Fly   260 GGFRNVDELADHLLQSGGTKVIFVTNGSAGVQVITNYVEELAPPGPVSFEDFRAQRVEQLVDATG 324
            ...::.::.|..:|:.|....| :|.|..||.:.:..|:::.....:..:         .||.||
 Worm   202 NNVKDAEKAARAMLKMGPQHAI-ITLGGKGVLLASKGVDDVEHTAVIKVD---------AVDTTG 256

  Fly   325 AGDAFVAGFLHAWLEKRSLGECIRMASSVAAKVVTQVG 362
            |||.|........:....:...||.|:::||..||:.|
 Worm   257 AGDCFCGSLAAHLVAGHPISASIRSAANLAALSVTRHG 294

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ady43ANP_651995.1 adenosine_kinase 28..366 CDD:238573 64/364 (18%)
PTZ00247 28..366 CDD:240328 64/364 (18%)
F07A11.5NP_496483.2 D_ribokin_bact 12..306 CDD:274000 62/358 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.