DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ady43A and ADK

Sequence 1:NP_651995.1 Gene:Ady43A FlyBaseID:FBgn0026602 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_006712.2 Gene:ADK HGNCID:257 Length:362 Species:Homo sapiens

Alignment Length:350 Identity:94/350 (27%)
Similarity:160/350 (46%) Gaps:27/350 (8%)


  Fly    29 RKVICF--GNVLLDRLVQLEDPQLLERFGLELGSKGELDMEKLNQLAAEASESSRCLTNPGGSAL 91
            |:.|.|  ||.||| :..:.|...|:::.|:...: .|..:|..:|..|..:..:...:.|||..
Human    22 RENILFGMGNPLLD-ISAVVDKDFLDKYSLKPNDQ-ILAEDKHKELFDELVKKFKVEYHAGGSTQ 84

  Fly    92 NTARI----LKQLGTDALFFGAVGADKHAEELRQIIRDRGIEARLQTVEDAHTGQCVCLMYQDNP 152
            |:.::    ::|....|.|||.:|.||..|.|::...:..::|......:..||.|...:..||.
Human    85 NSIKVAQWMIQQPHKAATFFGCIGIDKFGEILKRKAAEAHVDAHYYEQNEQPTGTCAACITGDNR 149

  Fly   153 TLYANIGASAQFEVQTLSHAVSHEGQSFLRPVERKQILYVEGFFVPQRSDVCDYIVQHLVRERRR 217
            :|.||:.|:..::.:  .| :..|....|  ||:.::.|:.|||:....:....:..|.....|.
Human   150 SLIANLAAANCYKKE--KH-LDLEKNWML--VEKARVCYIAGFFLTVSPESVLKVAHHASENNRI 209

  Fly   218 LALNLSAPYIVRKNHQAMMKLARAAFFLFGNRQEFEALAEAAG-GFRNVDELADHL-----LQSG 276
            ..||||||:|.:...:::||:......||||..|....|...| ..:::.|:|...     :.|.
Human   210 FTLNLSAPFISQFYKESLMKVMPYVDILFGNETEAATFAREQGFETKDIKEIAKKTQALPKMNSK 274

  Fly   277 GTKVIFVTNGSAGVQVITNYVEELAPPGPVSFEDFRAQRVEQLVDATGAGDAFVAGFLHAWLEKR 341
            ..:::..|.|.....:.|.        ..|:......|..::::|..|||||||.|||...:..:
Human   275 RQRIVIFTQGRDDTIMATE--------SEVTAFAVLDQDQKEIIDTNGAGDAFVGGFLSQLVSDK 331

  Fly   342 SLGECIRMASSVAAKVVTQVGCNLP 366
            .|.||||.....|:.::.:.||..|
Human   332 PLTECIRAGHYAASIIIRRTGCTFP 356

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ady43ANP_651995.1 adenosine_kinase 28..366 CDD:238573 93/349 (27%)
PTZ00247 28..366 CDD:240328 93/349 (27%)
ADKNP_006712.2 Nuclear localization signal. {ECO:0000269|PubMed:19635462} 8..16
PTZ00247 26..361 CDD:240328 92/346 (27%)
ribokinase_pfkB_like 29..361 CDD:294126 91/343 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S836
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1226324at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45769
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.