DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ady43A and Adk

DIOPT Version :9

Sequence 1:NP_651995.1 Gene:Ady43A / 44750 FlyBaseID:FBgn0026602 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_598840.1 Gene:Adk / 11534 MGIID:87930 Length:361 Species:Mus musculus


Alignment Length:342 Identity:92/342 - (26%)
Similarity:154/342 - (45%) Gaps:25/342 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GNVLLDRLVQLEDPQLLERFGLELGSKGELDMEKLNQLAAEASESSRCLTNPGGSALNTARILKQ 99
            ||.||| :..:.|...|:::.|:...: .|..:|..:|..|..:..:...:.|||..|:.::.:.
Mouse    29 GNPLLD-ISAVVDKDFLDKYSLKPNDQ-ILAEDKHKELFDELVKKFKVEYHAGGSTQNSMKVAQW 91

  Fly   100 LGTD----ALFFGAVGADKHAEELRQIIRDRGIEARLQTVEDAHTGQCVCLMYQDNPTLYANIGA 160
            |..:    |.|||.:|.||..|.|::...|..::|......:..||.|...:...|.:|.||:.|
Mouse    92 LIQEPHKAATFFGCIGIDKFGEILKRKAADAHVDAHYYEQNEQPTGTCAACITGGNRSLVANLAA 156

  Fly   161 SAQFEVQTLSHAVSHEGQSFLRPVERKQILYVEGFFVPQRSDVCDYIVQHLVRERRRLALNLSAP 225
            :..::.:  .| :..|....|  ||:.::.|:.|||:....:....:.::.....|...||||||
Mouse   157 ANCYKKE--KH-LDLERNWVL--VEKARVYYIAGFFLTVSPESVLKVARYAAENNRVFTLNLSAP 216

  Fly   226 YIVRKNHQAMMKLARAAFFLFGNRQEFEALAEAAG-GFRNVDELADHL-----LQSGGTKVIFVT 284
            :|.:...:|:|.:......||||..|....|...| ..:::.|:|...     :.|...:.:..|
Mouse   217 FISQFFKEALMDVMPYVDILFGNETEAATFAREQGFETKDIKEIAKKAQALPKVNSKRQRTVIFT 281

  Fly   285 NGSAGVQVITNYVEELAPPGPVSFEDFRAQRVEQLVDATGAGDAFVAGFLHAWLEKRSLGECIRM 349
            .|.....|        |....|:......|..|:::|..|||||||.|||...:..:.|.||||.
Mouse   282 QGRDDTIV--------AAENDVTAFPVLDQNQEEIIDTNGAGDAFVGGFLSQLVSDKPLTECIRA 338

  Fly   350 ASSVAAKVVTQVGCNLP 366
            ....|:.::.:.||..|
Mouse   339 GHYAASVIIRRTGCTFP 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ady43ANP_651995.1 adenosine_kinase 28..366 CDD:238573 91/340 (27%)
PTZ00247 28..366 CDD:240328 91/340 (27%)
AdkNP_598840.1 Nuclear localization signal. /evidence=ECO:0000250 7..15
ribokinase_pfkB_like 28..360 CDD:320807 92/342 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S836
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003751
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100649
Panther 1 1.100 - - LDO PTHR45769
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2162
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.720

Return to query results.
Submit another query.