DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ady43A and Adk

Sequence 1:NP_651995.1 Gene:Ady43A FlyBaseID:FBgn0026602 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_598840.1 Gene:Adk MGIID:87930 Length:361 Species:Mus musculus

Alignment Length:342 Identity:92/343 (27%)
Similarity:154/343 (45%) Gaps:25/343 (7%)


  Fly    35 GNVLLDRLVQLEDPQLLERFGLELGSKGELDMEKLNQLAAEASESSRCLTNPGGSALNTARILKQ 99
            ||.||| :..:.|...|:::.|:...: .|..:|..:|..|..:..:...:.|||..|:.::.:.
Mouse    29 GNPLLD-ISAVVDKDFLDKYSLKPNDQ-ILAEDKHKELFDELVKKFKVEYHAGGSTQNSMKVAQW 91

  Fly   100 LGTD----ALFFGAVGADKHAEELRQIIRDRGIEARLQTVEDAHTGQCVCLMYQDNPTLYANIGA 160
            |..:    |.|||.:|.||..|.|::...|..::|......:..||.|...:...|.:|.||:.|
Mouse    92 LIQEPHKAATFFGCIGIDKFGEILKRKAADAHVDAHYYEQNEQPTGTCAACITGGNRSLVANLAA 156

  Fly   161 SAQFEVQTLSHAVSHEGQSFLRPVERKQILYVEGFFVPQRSDVCDYIVQHLVRERRRLALNLSAP 225
            :..::.:  .| :..|....|  ||:.::.|:.|||:....:....:.::.....|...||||||
Mouse   157 ANCYKKE--KH-LDLERNWVL--VEKARVYYIAGFFLTVSPESVLKVARYAAENNRVFTLNLSAP 216

  Fly   226 YIVRKNHQAMMKLARAAFFLFGNRQEFEALAEAAG-GFRNVDELADHL-----LQSGGTKVIFVT 284
            :|.:...:|:|.:......||||..|....|...| ..:::.|:|...     :.|...:.:..|
Mouse   217 FISQFFKEALMDVMPYVDILFGNETEAATFAREQGFETKDIKEIAKKAQALPKVNSKRQRTVIFT 281

  Fly   285 NGSAGVQVITNYVEELAPPGPVSFEDFRAQRVEQLVDATGAGDAFVAGFLHAWLEKRSLGECIRM 349
            .|.....|        |....|:......|..|:::|..|||||||.|||...:..:.|.||||.
Mouse   282 QGRDDTIV--------AAENDVTAFPVLDQNQEEIIDTNGAGDAFVGGFLSQLVSDKPLTECIRA 338

  Fly   350 ASSVAAKVVTQVGCNLP 366
            ....|:.::.:.||..|
Mouse   339 GHYAASVIIRRTGCTFP 355

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ady43ANP_651995.1 adenosine_kinase 28..366 CDD:238573 91/341 (27%)
PTZ00247 28..366 CDD:240328 91/341 (27%)
AdkNP_598840.1 Nuclear localization signal. {ECO:0000250} 7..15
ribokinase_pfkB_like 28..360 CDD:320807 92/343 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S836
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45769
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.910

Return to query results.
Submit another query.