DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NiPp1 and AT5G47790

Sequence 1:NP_611177.1 Gene:NiPp1 FlyBaseID:FBgn0026402 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_199590.1 Gene:AT5G47790 AraportID:AT5G47790 Length:369 Species:Arabidopsis thaliana

Alignment Length:248 Identity:76/249 (31%)
Similarity:125/249 (50%) Gaps:37/249 (15%)


  Fly     8 PSWAGKPPTGLH-LDVLKDDKLVQKLMVDEKRCYLFGRNSQMNDFCIDHASCSRVHSAFVYHKHL 71
            |.||.:|..|:: |:|:||.:::.::.:|.:| ::|||..|..||.:||.|.||.|:|.|.||:.
plant    55 PDWAIEPRAGVYSLEVVKDGQILDRIHLDRRR-HIFGRQHQTCDFVLDHQSVSRQHAAVVPHKNG 118

  Fly    72 NIAYLVDLGSTHGTFIGTLRLEAHKPTQLQINSTFHFGASTRNYILRERPSGHHSNIMEDLPLSE 136
            :| :::||||.||||:...||....|.:|::..:..|.||||.|:||:......|   ...|.:|
plant   119 SI-FVIDLGSAHGTFVANERLTKDTPVELEVGQSLRFAASTRIYLLRKNSEALFS---RPPPPAE 179

  Fly   137 TSDGALLGLPESQTELDNLTEYNTAHNR-------RISMLGIDDDTNMRKQNALKQGRRTRNVTF 194
            ..    |..|...::.:.:..|||..||       ...|||...:....:....|:.::.| |:|
plant   180 IK----LPPPPDASDEEAVVAYNTLLNRYGLSNGESGGMLGKRKEKTGSEAGVAKRMKKVR-VSF 239

  Fly   195 NDE------EIVINPEDVDPN-------------VGRFRNLVQTTVVPAKRAR 228
            .|:      |||...:..|..             ||::.:||:.|::|..:.:
plant   240 RDQLGGELAEIVGMSDGADVETEPGPINVKEGSLVGKYESLVRVTLIPKGKVK 292

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NiPp1NP_611177.1 FHA 18..110 CDD:238017 36/93 (39%)
FHA <40..>87 CDD:224630 25/47 (53%)
AT5G47790NP_199590.1 FHA 65..154 CDD:238017 35/91 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 102 1.000 Inparanoid score I2094
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D955935at2759
OrthoInspector 1 1.000 T192340
orthoMCL 1 0.900 OOG5_132522
Panther 1 1.100 LDO PTHR23308
Phylome 1 0.910 0.875 Consistency score
76.970

Return to query results.
Submit another query.