DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NiPp1 and ppp1r8b

Sequence 1:NP_611177.1 Gene:NiPp1 FlyBaseID:FBgn0026402 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_957494.1 Gene:ppp1r8b ZFINID:ZDB-GENE-040426-1271 Length:349 Species:Danio rerio

Alignment Length:377 Identity:168/378 (44%)
Similarity:221/378 (58%) Gaps:48/378 (13%)


  Fly     5 YDIPSWAGKPPTGLHLDVLKDDKLVQKLMVDEKRCYLFGRNSQMNDFCIDHASCSRVHSAFVYHK 69
            :|.||||||||.||||||:|.||||:||::|||:.||||||..:.||.|||.||||||:|.|||:
Zfish    12 FDCPSWAGKPPAGLHLDVVKGDKLVEKLIIDEKKFYLFGRNPDICDFTIDHQSCSRVHAALVYHR 76

  Fly    70 HLNIAYLVDLGSTHGTFIGTLRLEAHKPTQLQINSTFHFGASTRNYILRERPSGHHSNIMEDLPL 134
            ||...:|:||.||||||:|.:|||.|||.|:.|:||..||||||.|.:||:|.......:.|:..
Zfish    77 HLKRLFLIDLNSTHGTFLGHIRLEPHKPQQVPIDSTMSFGASTRVYTIREKPQAQPGAGVGDIKT 141

  Fly   135 SETSD-GALLGLPESQTELDNLTEYNTAHNRRISMLGIDDDTNMRKQNALKQGRRTRNVTFNDEE 198
            .:..: ..||||||.:|||:||||:|||||:|||.|.|::. |:..|.. |:.||:..|:||:::
Zfish   142 GDDEELKGLLGLPEEETELENLTEFNTAHNKRISTLTIEEG-NLDIQRP-KRKRRSSRVSFNEDD 204

  Fly   199 IVINPEDVDPNVGRFRNLVQTTVVPAKRARC-DVNHMGIHSGNSSLSSANAAHVHQMFQQSLVDM 262
            .:||||||||:||||||:|.|.|||.|:.:. ..|.:||       ......|:|....|     
Zfish   205 EIINPEDVDPSVGRFRNMVSTAVVPIKKKKAGGSNALGI-------EETVTRHMHTFPLQ----- 257

  Fly   263 KQQHREMPPPNAVLHSPTNSLYQGLPAEMH-GKGDLEPISPLSIGSKLGLLLPNPAPEVLPVYDE 326
                              ..||:.||...| .:....|.....:|..: |.:|||||:|.|.::.
Zfish   258 ------------------GGLYRDLPPAGHEAQSTAGPGGATILGGMM-LPMPNPAPDVDPTHEA 303

  Fly   327 AVETSTLAQKLAVANANVRRFGEDPHDSSGEGDSLCPQKKKYAKEAWPGRKP 378
            ......:.....:....|       .|...|     |:|||||||||||:||
Zfish   304 LPPPPLMLNPTPMTGPYV-------SDVLNE-----PRKKKYAKEAWPGKKP 343

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NiPp1NP_611177.1 FHA 18..110 CDD:238017 60/92 (65%)
FHA <40..>87 CDD:224630 32/47 (68%)
ppp1r8bNP_957494.1 FHA 25..124 CDD:238017 65/99 (66%)
FHA <29..>107 CDD:224630 51/78 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C250931129
eggNOG 1 0.900 E1_KOG1880
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D400304at33208
OrthoFinder 1 1.000 FOG0004955
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_132522
Panther 1 1.100 O PTHR23308
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
98.720

Return to query results.
Submit another query.