DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NiPp1 and ppp1r8

Sequence 1:NP_611177.1 Gene:NiPp1 FlyBaseID:FBgn0026402 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_001017079.1 Gene:ppp1r8 XenbaseID:XB-GENE-479608 Length:346 Species:Xenopus tropicalis

Alignment Length:377 Identity:179/378 (47%)
Similarity:228/378 (60%) Gaps:51/378 (13%)


  Fly     5 YDIPSWAGKPPTGLHLDVLKDDKLVQKLMVDEKRCYLFGRNSQMNDFCIDHASCSRVHSAFVYHK 69
            ::.||||||||.||||||:|.|||::||::|||:.||||||..:.||.|||.||||||||.||||
 Frog    12 FECPSWAGKPPQGLHLDVVKGDKLIEKLIIDEKKYYLFGRNPDICDFTIDHQSCSRVHSALVYHK 76

  Fly    70 HLNIAYLVDLGSTHGTFIGTLRLEAHKPTQLQINSTFHFGASTRNYILRERPSGHHSNIMEDLPL 134
            ||...:|:||.||||||:|.:|||.|||.|:.|:||..||||||.|.|||:|....|.:..|...
 Frog    77 HLKRVFLIDLNSTHGTFLGHIRLEPHKPQQIPIDSTISFGASTRMYTLREKPQTLPSALKGDEKA 141

  Fly   135 SETSD-GALLGLPESQTELDNLTEYNTAHNRRISMLGIDDDTNMRKQNALKQGRRTRNVTFNDEE 198
            .|..: ..||||||.:||||||||:|||||:|||.|.|::. |:..|.. |:.|:...|||::::
 Frog   142 GEDDELKGLLGLPEEETELDNLTEFNTAHNKRISTLTIEEG-NIDIQRP-KRKRKNSRVTFSEDD 204

  Fly   199 IVINPEDVDPNVGRFRNLVQTTVVPAKRARCDVNHMGIHSGNSSLSSANAAHVHQMFQQSLVDMK 263
            .|||||||||:||||||:|||.|||.|:.:.::      .|:.||..:....|...         
 Frog   205 EVINPEDVDPSVGRFRNMVQTAVVPVKKKKTEI------PGSLSLEDSVGRRVQNF--------- 254

  Fly   264 QQHREMPPPNAVLHSP-TNSLYQGLPAEMHGKGDLEPISPLSIGSKLGLLLPNPAPEVLPVYDEA 327
                           | |..||.||| ..|.:|..:...........|:..||.||||    |.|
 Frog   255 ---------------PFTGGLYGGLP-PTHAEGGAQTAGGHGTALMGGMPFPNLAPEV----DLA 299

  Fly   328 VETSTLAQKLAVANANVRRFGEDPHDSSGEGDSLC-PQKKKYAKEAWPGRKP 378
            ..|:|:| .:.||          |..||...:::. |:|||||||||||:||
 Frog   300 PTTATVA-PITVA----------PAPSSFTAEAVNEPKKKKYAKEAWPGKKP 340

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NiPp1NP_611177.1 FHA 18..110 CDD:238017 61/92 (66%)
FHA <40..>87 CDD:224630 34/47 (72%)
ppp1r8NP_001017079.1 FHA 25..117 CDD:238017 61/92 (66%)
WASH_WAHD <96..268 CDD:314769 88/205 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C250929142
eggNOG 1 0.900 E1_KOG1880
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H8555
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D400304at33208
OrthoFinder 1 1.000 FOG0004955
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.720

Return to query results.
Submit another query.