DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NiPp1 and CG7706

Sequence 1:NP_611177.1 Gene:NiPp1 FlyBaseID:FBgn0026402 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_650742.2 Gene:CG7706 FlyBaseID:FBgn0038640 Length:726 Species:Drosophila melanogaster

Alignment Length:206 Identity:48/207 (23%)
Similarity:78/207 (38%) Gaps:42/207 (20%)


  Fly     5 YDIPSWAGKPPTG--LHLDVLKDDKLVQKL-MVDEKRCYLFGRNSQMNDFCIDHASCSRVHSAFV 66
            |.:|.|:..|...  ...:|||..:::..: .:.::..:.|||..: ||....|.:.||.|....
  Fly    50 YKVPKWSAPPAENQIYSFEVLKSGQIIDTVHQLQQQAVWTFGRLPE-NDVPAAHPTISRFHVVLQ 113

  Fly    67 Y-------------------------HKHLNIAYLVDLGSTHGTFIGTLRLEAHKPTQLQINSTF 106
            |                         :......|:.|:|||||||:...|:......::::....
  Fly   114 YKPKAPPKPETAKEDDEMEEEDEEPKNDQPEGWYIYDMGSTHGTFLNKQRVPPKVYIRMRVGHML 178

  Fly   107 HFGASTRNYILR-----ERPSGHHS-NIMEDLPLSETSDGALLGLPESQTELDNLTEYNTAHNRR 165
            ..|.|||.|||:     |.|....| ..:......|.:|.|:      :.||..|.......|..
  Fly   179 KLGGSTRVYILQGPGEDEEPESELSVTELRQKREKELADAAV------ERELRLLEAEERERNEG 237

  Fly   166 ISMLGIDDDTN 176
            :|. |:.||.:
  Fly   238 VSW-GMGDDAD 247

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NiPp1NP_611177.1 FHA 18..110 CDD:238017 24/118 (20%)
FHA <40..>87 CDD:224630 19/72 (26%)
CG7706NP_650742.2 FHA 69..190 CDD:238017 30/122 (25%)
FHA <84..215 CDD:224630 31/132 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D955935at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23308
RoundUp 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.