DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NiPp1 and CG17168

Sequence 1:NP_611177.1 Gene:NiPp1 FlyBaseID:FBgn0026402 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_001015254.1 Gene:CG17168 FlyBaseID:FBgn0039943 Length:421 Species:Drosophila melanogaster

Alignment Length:163 Identity:49/164 (30%)
Similarity:75/164 (46%) Gaps:23/164 (14%)


  Fly     5 YDIPSWAGKPPTGLHLDVLKDDKLVQKLMVDEKRCYLFGRNSQMNDFCIDHASCSRVHSAFVYH- 68
            |..|..|.||.....|...|.:..:..|.:..:.|:|.||:.::.|..:||.|||:.|:|..|. 
  Fly   268 YSEPPEARKPKRRWRLYPFKGETALPTLHIHRQSCFLVGRDRKVVDLAVDHPSCSKQHAALQYRL 332

  Fly    69 -----------KHLNIAYLVDLGSTHGTFIGTLRLEAHKPTQLQINSTFHFGASTRNYILRERPS 122
                       |.:.: ||:||.|.:|||:...:::|.|..:|.......||.|:|.|:|.    
  Fly   333 VPFEREDGSHGKRVRL-YLIDLDSANGTFLNNKKIDARKYYELIEKDVIKFGFSSREYVLL---- 392

  Fly   123 GHHSNIMEDLPLSETSDGALLGLP-ESQTELDN 154
              |.|..||   .|..|..:...| ::.||:.|
  Fly   393 --HENSKED---QEDDDVHIKDEPHDAPTEVAN 420

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NiPp1NP_611177.1 FHA 18..110 CDD:238017 30/104 (29%)
FHA <40..>87 CDD:224630 21/59 (36%)
CG17168NP_001015254.1 FHA 280..395 CDD:238017 35/122 (29%)
FHA <294..411 CDD:224630 38/127 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C114607080
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D955935at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23308
RoundUp 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.