DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NiPp1 and Ppp1r8

Sequence 1:NP_611177.1 Gene:NiPp1 FlyBaseID:FBgn0026402 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_001101381.1 Gene:Ppp1r8 RGDID:1306280 Length:351 Species:Rattus norvegicus

Alignment Length:380 Identity:178/381 (47%)
Similarity:227/381 (60%) Gaps:54/381 (14%)


  Fly     5 YDIPSWAGKPPTGLHLDVLKDDKLVQKLMVDEKRCYLFGRNSQMNDFCIDHASCSRVHSAFVYHK 69
            :|.|:||||||.||||||:|.|||::||::|||:.||||||..:.||.|||.||||||:|.||||
  Rat    14 FDCPTWAGKPPPGLHLDVVKGDKLIEKLIIDEKKYYLFGRNPDLCDFTIDHQSCSRVHAALVYHK 78

  Fly    70 HLNIAYLVDLGSTHGTFIGTLRLEAHKPTQLQINSTFHFGASTRNYILRERPSGHHSNIMEDLPL 134
            ||...:|:||.||||||:|.:|||.|||.|:.|:||..||||||.|.|||:|....|.:..|..:
  Rat    79 HLKRVFLIDLNSTHGTFLGHIRLEPHKPQQIPIDSTVSFGASTRAYTLREKPQTLPSAVKGDEKM 143

  Fly   135 SETSD--GALLGLPESQTELDNLTEYNTAHNRRISMLGIDDDTNMRKQNALKQGRRTRNVTFNDE 197
            ....|  ..||||||.:||||||||:|||||:|||.|.|::. |:..|.. |:.|:...|||:|:
  Rat   144 GGEDDELKGLLGLPEEETELDNLTEFNTAHNKRISTLTIEEG-NLDIQRP-KRKRKNSRVTFSDD 206

  Fly   198 EIVINPEDVDPNVGRFRNLVQTTVVPAKRARCDVNHMGIHSGNSSLSSANAAHVHQMFQQSLVDM 262
            :.:||||||||:||||||:|||.|||.|:.|.:      .||:..|..:.:..: |.|..|    
  Rat   207 DEIINPEDVDPSVGRFRNMVQTAVVPVKKKRME------GSGSLGLEESGSRRM-QNFAFS---- 260

  Fly   263 KQQHREMPPPNAVLHSPTNSLYQGLPAEMHGKGDLEP--ISPLSIGSKLGLLLPNPAPEV--LPV 323
                              ..||.||| ..|.:...:|  |...::...|.:..||.||:|  .||
  Rat   261 ------------------GGLYGGLP-PTHSEPGSQPHGIHGTALIGGLPMPYPNLAPDVDLTPV 306

  Fly   324 YDEAVETSTLAQKLAVANANVRRFGEDPHDSSGEGDSLCPQKKKYAKEAWPGRKP 378
            ...|| |.......||.|.          ::..|     |:|||||||||||:||
  Rat   307 VPSAV-TINPTPNPAVYNP----------EAVNE-----PKKKKYAKEAWPGKKP 345

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NiPp1NP_611177.1 FHA 18..110 CDD:238017 60/92 (65%)
FHA <40..>87 CDD:224630 33/47 (70%)
Ppp1r8NP_001101381.1 FHA 27..119 CDD:238017 60/92 (65%)
FHA <41..151 CDD:224630 62/110 (56%)
WASH_WAHD <98..>212 CDD:288773 58/116 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C250923675
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 1 1.000 H8555
Inparanoid 1 1.050 292 1.000 Inparanoid score I2647
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D400304at33208
OrthoFinder 1 1.000 FOG0004955
OrthoInspector 1 1.000 T1087296
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR23308
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
99.000

Return to query results.
Submit another query.