DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NiPp1 and B0511.7

Sequence 1:NP_611177.1 Gene:NiPp1 FlyBaseID:FBgn0026402 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_492781.2 Gene:B0511.7 WormBaseID:WBGene00015233 Length:302 Species:Caenorhabditis elegans

Alignment Length:382 Identity:141/383 (37%)
Similarity:191/383 (50%) Gaps:92/383 (24%)


  Fly     3 NSYDIPSWAGKPPTGLHLDVLKDDKLVQKLMVDEKRCYLFGRNSQMNDFCIDHASCSRVHSAFVY 67
            :.:.:||||.|||.|.||||.|.|.|:|||::|:|:.|.||||::..||.::||||||||:..:|
 Worm     8 SKFKVPSWAAKPPNGAHLDVQKGDALIQKLLIDDKKAYYFGRNNKQVDFAVEHASCSRVHALLLY 72

  Fly    68 HKHLNIAYLVDLGSTHGTFIGTLRLEAHKPTQLQINSTFHFGASTRNYILRERPSGHHSNIMEDL 132
            |..|....|:|:.|:||||:|.:||...:...:...:.||.|||||.|.:|.: :.||   :||.
 Worm    73 HGLLQRFALIDMDSSHGTFLGNVRLRPLEVVFMDPGTQFHLGASTRKYSVRLK-TEHH---VEDD 133

  Fly   133 PLSETSDGALLGLPESQTELDNLTEYNTAHNRRISMLGIDDDTNMRKQNALKQGRRTRNVTFNDE 197
            |....||          .:||:.|.||||.||||..|.|..:...||:      |...||.|.:|
 Worm   134 PTVAASD----------EQLDHQTSYNTAQNRRIPQLPISVEEARRKK------RPRGNVAFLEE 182

  Fly   198 EIVINPEDVDPNVGRFRNLVQTTVV---PAKRARCDVNHMGIHSGNSSLSSANAAHVHQMFQQSL 259
            |.|||||||||:||||||||.|.::   |.||           .|:...|               
 Worm   183 EEVINPEDVDPSVGRFRNLVTTAIISTNPNKR-----------PGDPKRS--------------- 221

  Fly   260 VDMKQQHREMPPPNAVLHSPTNSLYQGLPAEMHGKGDLEPISPLSIGSKLGLLLPNPAPEVLPVY 324
               :...:.:.|...::.:|.:|.:.  |..::...|||         ..|.|||.|.      :
 Worm   222 ---EPPRKIVRPGRELMSAPLSSTFG--PMALNAAPDLE---------LYGKLLPEPG------H 266

  Fly   325 DEAVETSTLAQKLAVANANVRRFGEDPHDSSGEGDSLCPQKKKYAKEAWPGRKPMLG 381
            .:.| |||..:..|          :|.|            ||:|||||||||||..|
 Worm   267 HQYV-TSTATEDEA----------DDHH------------KKRYAKEAWPGRKPGAG 300

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NiPp1NP_611177.1 FHA 18..110 CDD:238017 43/92 (47%)
FHA <40..>87 CDD:224630 25/47 (53%)
B0511.7NP_492781.2 FHA 23..126 CDD:238017 49/104 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C250910270
eggNOG 1 0.900 E1_KOG1880
Hieranoid 1 1.000
Homologene 1 1.000 H8555
Inparanoid 1 1.050 202 1.000 Inparanoid score I2427
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D400304at33208
OrthoFinder 1 1.000 FOG0004955
OrthoInspector 1 1.000 T475803
orthoMCL 1 0.900 OOG5_132522
Panther 1 1.100 LDO PTHR23308
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3572
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.