DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NiPp1 and Ppp1r8

Sequence 1:NP_611177.1 Gene:NiPp1 FlyBaseID:FBgn0026402 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_001342127.1 Gene:Ppp1r8 MGIID:2140494 Length:377 Species:Mus musculus

Alignment Length:373 Identity:175/374 (47%)
Similarity:223/374 (60%) Gaps:52/374 (14%)


  Fly    11 AGKPPTGLHLDVLKDDKLVQKLMVDEKRCYLFGRNSQMNDFCIDHASCSRVHSAFVYHKHLNIAY 75
            |||||.||||||:|.|||::||::|||:.||||||..:.||.|||.||||||:|.||||||...:
Mouse    46 AGKPPPGLHLDVVKGDKLIEKLIIDEKKYYLFGRNPDLCDFTIDHQSCSRVHAALVYHKHLKRVF 110

  Fly    76 LVDLGSTHGTFIGTLRLEAHKPTQLQINSTFHFGASTRNYILRERPSGHHSNIMEDLPLSETSD- 139
            |:||.||||||:|.:|||.|||.|:.|:||..||||||.|.|||:|....|.:..|..:....| 
Mouse   111 LIDLNSTHGTFLGHIRLEPHKPQQIPIDSTVSFGASTRAYTLREKPQTLPSAVKGDEKMGGEDDE 175

  Fly   140 -GALLGLPESQTELDNLTEYNTAHNRRISMLGIDDDTNMRKQNALKQGRRTRNVTFNDEEIVINP 203
             ..||||||.:||||||||:|||||:|||.|.|::. |:..|.. |:.|:...|||::::.:|||
Mouse   176 LKGLLGLPEEETELDNLTEFNTAHNKRISTLTIEEG-NLDIQRP-KRKRKNSRVTFSEDDEIINP 238

  Fly   204 EDVDPNVGRFRNLVQTTVVPAKRARCDVNHMGIHSGNSSLSSANAAHVHQM-FQQSLVDMKQQHR 267
            |||||:||||||:|||.|||.|:.|.:      .||:..|..:.:..:... |...|      :.
Mouse   239 EDVDPSVGRFRNMVQTAVVPVKKKRME------GSGSLGLEESGSRRMQNFAFSGGL------YG 291

  Fly   268 EMPPPNAVLHSPTNSLYQGLPAEMHGKGDLEPISPLSIGSKLGLLLPNPAPEV--LPVYDEAVET 330
            .:||    .||.|.|...|:    ||..        .||. |.:..||.||:|  .||...||..
Mouse   292 GLPP----THSETGSQPHGI----HGTA--------LIGG-LPMPYPNLAPDVDLTPVVPSAVAI 339

  Fly   331 STLAQKLAVANANVRRFGEDPHDSSGEGDSLCPQKKKYAKEAWPGRKP 378
            :..... ||.|.          ::..|     |:|||||||||||:||
Mouse   340 NPTPNP-AVYNP----------EAVNE-----PKKKKYAKEAWPGKKP 371

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NiPp1NP_611177.1 FHA 18..110 CDD:238017 60/92 (65%)
FHA <40..>87 CDD:224630 33/47 (70%)
Ppp1r8NP_001342127.1 FHA 53..145 CDD:238017 60/92 (65%)
WASH_WAHD <124..>238 CDD:314769 57/116 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C250926045
eggNOG 1 0.900 E1_KOG1880
Hieranoid 1 1.000
Homologene 1 1.000 H8555
Inparanoid 1 1.050 291 1.000 Inparanoid score I2765
Isobase 1 0.950 0 Normalized mean entropy S4121
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D955935at2759
OrthoFinder 1 1.000 FOG0004955
OrthoInspector 1 1.000 T1083742
orthoMCL 1 0.900 OOG5_132522
Panther 1 1.100 LDO PTHR23308
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3572
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.