DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: MED6 and med6

Sequence 1:NP_001163577.1 Gene:MED6 FlyBaseID:FBgn0024330 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001016292.1 Gene:med6 XenbaseID:XB-GENE-967312 Length:246 Species:Xenopus tropicalis

Alignment Length:259 Identity:116/260 (45%)
Similarity:160/260 (62%) Gaps:25/260 (10%)


  Fly     1 MASRQMTNDHLRLSWHDTQMMATLSPQTVMDYFCRKSNPFYDHMCNNETVRMQRLGPEHLHNMIG 65
            ||:..:.::.|.:||.|:..:..|:..||:|||..:||||||..||||.|:||||..:||:.|:|
 Frog     1 MAAVDIRDNLLGISWVDSSWIPILNNGTVLDYFSERSNPFYDRTCNNEVVKMQRLTLDHLNQMVG 65

  Fly    66 LEYILLHVAEPILYVIRKQHRHNPSEATPIADYYIIGGTVYKAPDLANVINSRILNTVVNLQSAF 130
            :||||||..||||::||||.|.:|::..|:||||||.|.:|:||||.:|||||:|..|..:||||
 Frog    66 IEYILLHAQEPILFIIRKQQRQSPTQVIPLADYYIIAGVIYQAPDLGSVINSRVLTAVHGIQSAF 130

  Fly   131 EEASSYARYHPNKGYTWDFSSNKVFSDRSKSDKKDANSAKDENSGTLFQKQRVDMLLAELLRKFP 195
            :||.||.||||:|||.|.      |.|:.:.||....:.|.|.:.:.||:||||.||.||.:|||
 Frog   131 DEAMSYCRYHPSKGYWWH------FKDQEERDKTKPKAKKKEEASSHFQRQRVDALLMELRQKFP 189

  Fly   196 P----------PIPPMLQNLQQPPPAGDDLNTARNASEMNNATGPLDIKTEGVDMKPPPEKKSK 249
            |          |:|......:..|||    .|.:...:     .|:.:..:|...|.||||:.:
 Frog   190 PKFIQQKTGEKPVPVEQIKKEAEPPA----ETIKQEEK-----EPVKVAQQGATPKGPPEKRMR 244

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MED6NP_001163577.1 Med6 13..139 CDD:282750 73/126 (58%)
med6NP_001016292.1 Med6 13..139 CDD:282750 73/126 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C176171655
eggNOG 1 0.900 E1_COG5097
Hieranoid 1 1.000
Homologene 1 1.000 H3990
Inparanoid 1 1.050 225 1.000 Inparanoid score I3295
OMA 1 1.010
OrthoDB 1 1.010 D1251252at2759
OrthoFinder 1 1.000 FOG0004260
OrthoInspector 1 1.000 T1059402
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2638
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.