DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lolal and AT4G08455

DIOPT Version :10

Sequence 1:NP_524778.1 Gene:lolal / 44703 FlyBaseID:FBgn0022238 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_680660.3 Gene:AT4G08455 / 826404 AraportID:AT4G08455 Length:270 Species:Arabidopsis thaliana


Alignment Length:94 Identity:31/94 - (32%)
Similarity:46/94 - (48%) Gaps:7/94 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KSFTDVTLACEGQTC-----KAHKMVLSACSPYFKALLEE--NPSKHPIIILKDVSYIHLQAILE 87
            :|||||.|.......     .|||.||.:.||.|||:||.  ..|....|.:.||||..|:..:.
plant    88 RSFTDVVLIASEDNAGSPPIPAHKSVLVSRSPVFKAMLENEMEESLSGTIKISDVSYDALRTFVY 152

  Fly    88 FMYAGEVNVSQEQLPAFLKTADRLKVKGL 116
            ::|..|..:.::.....|..:::.:||.|
plant   153 YLYTAEACLDEQMACDLLVMSEKYQVKHL 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lolalNP_524778.1 BTB_POZ_BAB-like 32..115 CDD:349624 28/89 (31%)
AT4G08455NP_680660.3 BTB_POZ_ZBTB_KLHL-like 90..176 CDD:349497 27/85 (32%)
BACK 194..248 CDD:350515
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.