DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lolal and AT2G05330

DIOPT Version :10

Sequence 1:NP_524778.1 Gene:lolal / 44703 FlyBaseID:FBgn0022238 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_178602.1 Gene:AT2G05330 / 815081 AraportID:AT2G05330 Length:215 Species:Arabidopsis thaliana


Alignment Length:78 Identity:18/78 - (23%)
Similarity:38/78 - (48%) Gaps:8/78 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 MVLSACSPYFKALLEENPSKHP-----IIILKDVSYIHLQAILEFMYAGEVNVS---QEQLPAFL 105
            :::::.|...|.:||.:..|..     .|.|.::....|:|.:||:|:....:|   ::...|..
plant    33 VMMASRSAVLKKMLESDEFKTSAKQVGTITLLEMKQEELEAFVEFLYSDGSMLSSKVKQHARALY 97

  Fly   106 KTADRLKVKGLAE 118
            :.||:.::..|.|
plant    98 RAADKYEILRLRE 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lolalNP_524778.1 BTB_POZ_BAB-like 32..115 CDD:349624 16/73 (22%)
AT2G05330NP_178602.1 BTB_POZ <35..120 CDD:453885 18/76 (24%)
Ribosomal_L37e 186..>215 CDD:469997
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.