DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lolal and BTBD18

DIOPT Version :10

Sequence 1:NP_524778.1 Gene:lolal / 44703 FlyBaseID:FBgn0022238 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_001138573.1 Gene:BTBD18 / 643376 HGNCID:37214 Length:712 Species:Homo sapiens


Alignment Length:106 Identity:37/106 - (34%)
Similarity:58/106 - (54%) Gaps:7/106 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 HLRDEKSFTDVTLACEGQTCKAHKMVLSACSPYFKALLE-ENPSKHPIIILK--DVSYIHLQAIL 86
            |.:....|.||.|..||:...||..:||||||:|...|| |.|::...::|:  .:....|:.::
Human    26 HQQQSDVFCDVLLQAEGEAVPAHCCILSACSPFFTERLERERPAQGGKVVLELGGLKISTLRKLV 90

  Fly    87 EFMYAGEVNVSQEQLPAFLKTADRLKVKGLAETPSSIKREG 127
            :|:|..|:.||||:....|..|.:|:|..|    .|::.||
Human    91 DFLYTSEMEVSQEEAQDVLSAARQLRVSEL----ESLQLEG 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lolalNP_524778.1 BTB_POZ_BAB-like 32..115 CDD:349624 32/85 (38%)
BTBD18NP_001138573.1 BTB_POZ_BTBD18 19..138 CDD:349602 37/106 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..176
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..355
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 374..410
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 653..676
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 691..712
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.