DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lolal and CG34376

DIOPT Version :10

Sequence 1:NP_524778.1 Gene:lolal / 44703 FlyBaseID:FBgn0022238 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_732741.1 Gene:CG34376 / 42638 FlyBaseID:FBgn0085405 Length:681 Species:Drosophila melanogaster


Alignment Length:118 Identity:58/118 - (49%)
Similarity:79/118 - (66%) Gaps:0/118 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DQQFFLKWNDFQTNMVTSFRHLRDEKSFTDVTLACEGQTCKAHKMVLSACSPYFKALLEENPSKH 69
            |.:|.|.|.:||.|:.:.|::|.|.....||||||:|:...|||:||:.|||||:.:...||.||
  Fly     2 DDEFKLCWKNFQDNIASGFQNLYDRGDLVDVTLACDGKLLHAHKIVLAICSPYFQEIFTTNPCKH 66

  Fly    70 PIIILKDVSYIHLQAILEFMYAGEVNVSQEQLPAFLKTADRLKVKGLAETPSS 122
            |||||||||:..:..:|||||.|.|||...:|.:|:|....|::||||...:|
  Fly    67 PIIILKDVSFNIMMELLEFMYQGVVNVKHTELQSFMKIGQLLQIKGLATNSNS 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lolalNP_524778.1 BTB_POZ_BAB-like 32..115 CDD:349624 43/82 (52%)
CG34376NP_732741.1 BTB_POZ_BAB-like 29..112 CDD:349624 43/82 (52%)
FLYWCH 387..443 CDD:461332
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.