powered by:
Protein Alignment lolal and BtbVII
DIOPT Version :9
| Sequence 1: | NP_001163186.1 |
Gene: | lolal / 44703 |
FlyBaseID: | FBgn0022238 |
Length: | 127 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_647774.2 |
Gene: | BtbVII / 38376 |
FlyBaseID: | FBgn0263108 |
Length: | 907 |
Species: | Drosophila melanogaster |
| Alignment Length: | 118 |
Identity: | 68/118 - (57%) |
| Similarity: | 86/118 - (72%) |
Gaps: | 0/118 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 4 SDQQFFLKWNDFQTNMVTSFRHLRDEKSFTDVTLACEGQTCKAHKMVLSACSPYFKALLEENPSK 68
|.|||.|:||:.|.|.::....|....:..|||||.||:..:|||:||||||.||:||...||.:
Fly 2 SVQQFCLRWNNHQPNFISVCSSLLHNGTLVDVTLAAEGRQLQAHKIVLSACSSYFQALFTTNPCQ 66
Fly 69 HPIIILKDVSYIHLQAILEFMYAGEVNVSQEQLPAFLKTADRLKVKGLAETPS 121
|||:|||||.|..|:.:::|||.|||||||||||..||||:.||:|||||.|:
Fly 67 HPIVILKDVQYDDLKTMVDFMYYGEVNVSQEQLPHILKTAEMLKIKGLAEMPT 119
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
1 |
1.000 |
59 |
1.000 |
Domainoid score |
I10615 |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
1 |
1.010 |
- |
- |
|
D1229475at2759 |
| OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000141 |
| OrthoInspector |
1 |
1.000 |
- |
- |
|
otm40394 |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
5 | 4.920 |
|
Return to query results.
Submit another query.