DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: lolal and BtbVII

Sequence 1:NP_001163186.1 Gene:lolal FlyBaseID:FBgn0022238 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_647774.2 Gene:BtbVII FlyBaseID:FBgn0263108 Length:907 Species:Drosophila melanogaster

Alignment Length:118 Identity:68/119 (57%)
Similarity:86/119 (72%) Gaps:0/119 (0%)


  Fly     4 SDQQFFLKWNDFQTNMVTSFRHLRDEKSFTDVTLACEGQTCKAHKMVLSACSPYFKALLEENPSK 68
            |.|||.|:||:.|.|.::....|....:..|||||.||:..:|||:||||||.||:||...||.:
  Fly     2 SVQQFCLRWNNHQPNFISVCSSLLHNGTLVDVTLAAEGRQLQAHKIVLSACSSYFQALFTTNPCQ 66

  Fly    69 HPIIILKDVSYIHLQAILEFMYAGEVNVSQEQLPAFLKTADRLKVKGLAETPS 121
            |||:|||||.|..|:.:::|||.|||||||||||..||||:.||:|||||.|:
  Fly    67 HPIVILKDVQYDDLKTMVDFMYYGEVNVSQEQLPHILKTAEMLKIKGLAEMPT 119

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lolalNP_001163186.1 BTB 23..118 CDD:306997 57/95 (60%)
BtbVIINP_647774.2 BTB 24..117 CDD:279045 58/93 (62%)
BTB 32..117 CDD:197585 57/85 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000318
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.