DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lolal and chinmo

DIOPT Version :10

Sequence 1:NP_524778.1 Gene:lolal / 44703 FlyBaseID:FBgn0022238 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_722717.2 Gene:chinmo / 33343 FlyBaseID:FBgn0086758 Length:840 Species:Drosophila melanogaster


Alignment Length:117 Identity:55/117 - (47%)
Similarity:77/117 - (65%) Gaps:1/117 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MSSDQQFFLKWNDFQTNMVTSFRHLRDEKSFTDVTLACEGQTCKAHKMVLSACSPYFKALLEENP 66
            |...|||.||||.|.:|:..:|.:|.......||.|:|:|...||||::|:|||..|..|.|..|
  Fly     1 MDPQQQFCLKWNSFSSNLAITFSNLFKSDLLADVILSCDGVVFKAHKLILAACSKKFADLFENTP 65

  Fly    67 SK-HPIIILKDVSYIHLQAILEFMYAGEVNVSQEQLPAFLKTADRLKVKGLA 117
            :. ..:|||:..:..::.|:|||||.|||:||||.|.:|||:|:.|:||||:
  Fly    66 TNGQCVIILEATTPDNMAALLEFMYKGEVHVSQEALNSFLKSAESLQVKGLS 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lolalNP_524778.1 BTB_POZ_BAB-like 32..115 CDD:349624 40/83 (48%)
chinmoNP_722717.2 BTB_POZ_BAB-like 31..115 CDD:349624 40/83 (48%)
C2H2 Zn finger 519..540 CDD:275368
C2H2 Zn finger 547..568 CDD:275368
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.