DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lolal and CG8924

DIOPT Version :10

Sequence 1:NP_524778.1 Gene:lolal / 44703 FlyBaseID:FBgn0022238 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_573091.1 Gene:CG8924 / 32557 FlyBaseID:FBgn0030710 Length:514 Species:Drosophila melanogaster


Alignment Length:128 Identity:55/128 - (42%)
Similarity:87/128 - (67%) Gaps:3/128 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMSSDQQFFLKWNDFQTNMVTSFRHLRDEKSFTDVTLACEGQTCKAHKMVLSACSPYFKALLEEN 65
            |..:.|:|.::||....::..:|..|...:.|.|||||||||....|::||:|||.||:|:|.|:
  Fly     1 MSGATQEFCVRWNSHLGSIGAAFPQLLAGQRFVDVTLACEGQQVHCHRLVLAACSTYFEAILAEH 65

  Fly    66 PSKHPIIIL-KDVSYIHLQAILEFMYAGEVNVSQEQLPAFLKTADRLKVKGL--AETPSSIKR 125
            |.|||:||| :::....:||:::|||.|||||:|..|...|:.|::|:::||  :|.|.:.|:
  Fly    66 PCKHPVIILPREIKLWEIQALVDFMYKGEVNVTQAGLGQLLRCAEQLQIRGLYGSEAPINYKK 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lolalNP_524778.1 BTB_POZ_BAB-like 32..115 CDD:349624 43/83 (52%)
CG8924NP_573091.1 BTB_POZ_BAB-like 32..116 CDD:349624 43/83 (52%)
MerR 378..407 CDD:425647
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.