DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lolal and CG32121

DIOPT Version :10

Sequence 1:NP_524778.1 Gene:lolal / 44703 FlyBaseID:FBgn0022238 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_001097599.1 Gene:CG32121 / 317867 FlyBaseID:FBgn0052121 Length:648 Species:Drosophila melanogaster


Alignment Length:120 Identity:50/120 - (41%)
Similarity:81/120 - (67%) Gaps:1/120 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SDQQFFLKWNDFQTNMVTSFRHLRDEKSFTDVTLACEGQTCKAHKMVLSACSPYFKALLEE-NPS 67
            |.|||.|:|::.||:::::...|.|:...||||::.||:..:||::||||||.:|..:... ..|
  Fly    26 SQQQFCLRWHNHQTSLLSTLPILLDQSHLTDVTISAEGRQLRAHRVVLSACSSFFMDIFRALEAS 90

  Fly    68 KHPIIILKDVSYIHLQAILEFMYAGEVNVSQEQLPAFLKTADRLKVKGLAETPSS 122
            .||:||:...|:..:.::|.|||:|||||.:||:|..|..|:.|.:||||:..::
  Fly    91 NHPVIIIPGASFGAIVSLLTFMYSGEVNVYEEQIPMLLNLAETLGIKGLADVQNN 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lolalNP_524778.1 BTB_POZ_BAB-like 32..115 CDD:349624 36/83 (43%)
CG32121NP_001097599.1 BTB_POZ_BAB-like 54..138 CDD:349624 36/83 (43%)
C2H2 Zn finger 474..494 CDD:275370
C2H2 Zn finger 501..518 CDD:275370
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.