DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lolal and CG3726

DIOPT Version :10

Sequence 1:NP_524778.1 Gene:lolal / 44703 FlyBaseID:FBgn0022238 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_001284917.1 Gene:CG3726 / 31525 FlyBaseID:FBgn0029824 Length:682 Species:Drosophila melanogaster


Alignment Length:114 Identity:59/114 - (51%)
Similarity:79/114 - (69%) Gaps:1/114 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 QQFFLKWNDFQTNMVTSFRHLRDEKSFTDVTLACEGQTCKAHKMVLSACSPYFKALLEENPS-KH 69
            ||:.|:|....:|:.|.|..|.|...|.|||||||||..:||::||.|||.:|.|:|....| :.
  Fly     4 QQYCLRWKYHHSNLQTMFSQLLDRGCFCDVTLACEGQLIRAHRVVLCACSTFFDAVLSNYASERD 68

  Fly    70 PIIILKDVSYIHLQAILEFMYAGEVNVSQEQLPAFLKTADRLKVKGLAE 118
            ||||:|||::..::.::||||.||:||....||:.|||||.||:|||||
  Fly    69 PIIIMKDVTFAEVKCLIEFMYKGEINVEHSSLPSLLKTADDLKIKGLAE 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lolalNP_524778.1 BTB_POZ_BAB-like 32..115 CDD:349624 45/83 (54%)
CG3726NP_001284917.1 BTB_POZ_BAB-like 30..114 CDD:349624 45/83 (54%)
HTH_psq 587..622 CDD:283007
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.