DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lolal and Zbtb9

DIOPT Version :10

Sequence 1:NP_524778.1 Gene:lolal / 44703 FlyBaseID:FBgn0022238 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_998729.1 Gene:Zbtb9 / 294289 RGDID:1303050 Length:465 Species:Rattus norvegicus


Alignment Length:124 Identity:39/124 - (31%)
Similarity:65/124 - (52%) Gaps:7/124 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 QQFFLKWNDFQTNMVTSFRHLRDEKSFTDVTLACEGQTCKAHKMVLSACSPYF--KALLEENPS- 67
            |...:.:....::::.|....|.|..|.||:|..:|:..:|||.||:|.||||  |.||.:.|. 
  Rat    21 QTIHIDFPHHSSSLLESLNRHRLEGKFCDVSLLVQGRELRAHKAVLAAASPYFHDKLLLGDAPRL 85

  Fly    68 KHPIIILKDVSYIHLQAILEFMYAGEVNVSQEQLPAFLKTADRLKVKGLAETPSSIKRE 126
            ..|.:|..|.    .:.:|:.:|:|.:::..:.|||.|..|..|::..:.:..|.|.||
  Rat    86 TLPNVIEADA----FEGLLQLIYSGSLHLPLDALPAHLLVASGLQMWQVVDRCSEILRE 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lolalNP_524778.1 BTB_POZ_BAB-like 32..115 CDD:349624 31/85 (36%)
Zbtb9NP_998729.1 BTB_POZ 30..140 CDD:453885 36/113 (32%)
C2H2 Zn finger 380..397 CDD:275368
C2H2 Zn finger 405..425 CDD:275368
zf-C2H2 405..425 CDD:395048
C2H2 Zn finger 432..449 CDD:275368
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.